CATH Domain: 2qm1A01 XML data for domain: 2qm1A01

Molscript image for 2qm1A01
2qm1A01
PDB coordinates for domain 2qm1A01

PDB 2qm1, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.40 Gene3D
3.30.420.40.11
3.30.420.40.11.1
3.30.420.40.11.1.1
3.30.420.40.11.1.1.1
3.30.420.40.11.1.1.1.1

[top]
Segment boundaries for domain 2qm1A01

Chopping figure for domain 2qm1A01
DomainStart PDB ResidueStop PDB Residue
2qm1A01 -2 129
2qm1A01 303 321
2qm1A02 130 302

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 3.30.420.40.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1z05A02 86.96 Vibrio choleraeTranscriptional regulator, ROK family 3.30.420.40 154 20 91 2.42 2.64
2hoeA02 86.49 Thermotoga maritimaTranscriptional regulator, XylR-related 3.30.420.40 146 18 93 2.90 3.09
1huxA01 80.40 Activator of (R)-2-hydroxyglutaryl-CoA dehydrataseAcidaminococcus fermentans DSM 20731 3.30.420.40 119 21 76 3.19 4.18
2qxlB01 80.35 ATP bindingCytoplasmAdenyl-nucleotide exchange factor activityHeat shock protein homolog SSE1Peptide binding 3.30.420.40 134 14 82 3.51 4.26
3h1qA01 80.34 Ethanolamine utilization protein EutJCarboxydothermus hydrogenoformans Z-2901Ethanolamine utilization protein EutJ 3.30.420.40 152 10 82 4.10 4.99
2gupA01 79.81 ROK family proteinStreptococcus pneumoniae 3.30.420.40 96 32 64 2.35 3.62
1sz2B01 79.78 Galactose metabolismAmino sugar and nucleotide sugar metabolismMetabolic pathwaysStarch and sucrose metabolismGlycolysis / Gluconeogenesis 3.30.420.40 118 16 75 3.27 4.32
1woqA01 79.44 Inorganic polyphosphate/ATP-glucomannokinaseArthrobacter sp. KM 3.30.420.40 112 20 72 2.70 3.70
3epqA01 78.37 3.30.420.40 91 23 58 2.12 3.65
1ig8A02 78.01 Galactose metabolismRegulation of cell sizeMannose metabolic processGlucose importMetabolic pathways 3.30.420.40 134 11 76 3.47 4.54
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qm1A01
SNADKKIIGIDLGGTTIKFAILTTDGVVQQKWSIETNILEDGKHIVPSIIESIRHRIDLYNKKEDFVGIGGTPGSVDIEK
GTVVGAYNLNWTTVQPVKEQIESALGIPFALDNDANVAALGERWKGAGELGNEAGVIGAASLALQFSK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qm1A01
SNAXDKKIIGIDLGGTTIKFAILTTDGVVQQKWSIETNILEDGKHIVPSIIESIRHRIDLYNXKKEDFVGIGXGTPGSVD
IEKGTVVGAYNLNWTTVQPVKEQIESALGIPFALDNDANVAALGERWKGAGELGNEAGVIGAASLALQFSKEK
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 06 Jan 2009 15:52

Assigning to "3.30.420.40" based on similarity with "2qm1D01"

Flow stage update by auto on 06 Jan 2009 15:49

No in_process hits for Domain "2qm1A01" ready to be processed

Update comment by auto on 06 Jan 2009 15:42

Domain "2qm1A01" hits Domain "2qm1D01" (98.0392156862745% over 100%) which is currently in process

Update comment by auto on 06 Jan 2009 15:24

Domain "2qm1A01" hits Domain "2qm1C01" (98.0392156862745% over 100%) which is currently in process

Update comment by auto on 14 Sep 2008 17:14

Domain "2qm1A01" hits Domain "2qm1B01" (98.0392156862745% over 100%) which is currently in process

Flow stage update by auto on 14 Sep 2008 17:11

Domain "2qm1A01" hits Domain "2qm1B01" (98.0392156862745% over 100%) which is currently in process

Flow stage update by auto on 14 Sep 2008 17:11

NW result present for Domain "2qm1A01"

Flow stage update by auto on 11 Sep 2008 11:06

All required files are present for Domain "2qm1A01"

Flow stage update by auto on 10 Sep 2008 17:44

Beginning processing for Domain "2qm1A01"

Insertion by cuff on 10 Sep 2008 12:23

nice chopping