CATH Domain: 2qltA02 XML data for domain: 2qltA02

Molscript image for 2qltA02
2qltA02
PDB coordinates for domain 2qltA02

PDB 2qlt, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.150 DNA polymerase; domain 1
1.10.150.240 Putative phosphatase; domain 2 Gene3D
1.10.150.240.14
1.10.150.240.14.1
1.10.150.240.14.1.1
1.10.150.240.14.1.1.1
1.10.150.240.14.1.1.1.1

[top]
Segment boundaries for domain 2qltA02

Chopping figure for domain 2qltA02
DomainStart PDB ResidueStop PDB Residue
2qltA01 27 47
2qltA01 110 265
2qltA02 48 109

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 1.10.150.240.14.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2nyvA02 82.66 Phosphoglycolate phosphatase [EC:3.1.3.18]Metabolic pathwaysGlyoxylate and dicarboxylate metabolismAquifex aeolicusPhosphoglycolate phosphatase 1.10.150.240 64 18 93 2.67 2.85
2ah5A02 81.98 Glyoxylate and dicarboxylate metabolismMetabolic pathwaysPhosphoglycolate phosphatase [EC:3.1.3.18]Hydrolase, haloacid dehalogenase-like familyStreptococcus pneumoniae 1.10.150.240 64 13 85 3.16 3.68
1rykA00 77.17 UPF0337 protein yjbJProtein bindingEscherichia coli K-12 1.10.1470.10 69 11 85 3.93 4.60
2hcfA02 76.98 Chlorobaculum tepidumHydrolase, haloacid dehalogenase-like family 1.10.150.240 63 10 84 3.85 4.58
2fj6A01 74.71 UPF0346 protein yozEBacillus subtilis 1.10.150.260 72 3 76 3.77 4.94
3e58A02 74.46 Streptococcus thermophilus LMG 18311Beta-phosphoglucomutase, putative 1.10.150.240 62 8 85 3.48 4.07
1swvA02 73.76 Bacillus cereusPhosphonoacetaldehyde hydrolase 1.10.150.240 78 15 75 2.87 3.79
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qltA02
QPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAPDFADEEYVNKLEGEIPEKYGE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qltA02
QPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAPDFADEEYVNKLEGEIPEKYGE
BLAST against CATH

[top]
Domain History Events (73)

Domain assigned by cuff on 15 Mar 2009 14:18

same superfamily

Domain assignment manual match h by cuff on 15 Mar 2009 14:16

homology match

Homcheck allotment by cuff on 06 Jan 2009 15:08

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 06 Jan 2009 15:08

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Oct 2008 21:47

Domain "2qltA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Oct 2008 21:47

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qltA02

Flow stage update by auto on 15 Oct 2008 21:26

Retrieved PRC_PFAMCATH results for job ID SID7705344943809504 and results inserted.

Domain scan prc pfamcath by auto on 15 Oct 2008 21:26

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2qltA02

Update comment by auto on 14 Oct 2008 09:09

PRC_PFAMCATH job SID7705344943809504 is not yet finished.

Flow stage update by auto on 14 Oct 2008 09:04

The entry "2qltA02" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 14 Oct 2008 09:04

The entry "2qltA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 14 Oct 2008 08:47

Retrieved SSAP results for job ID SID6070053779193696 and results inserted.

Domain scan ssap cath by auto on 14 Oct 2008 08:45

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2329 results for 2qltA02

Update comment by auto on 10 Oct 2008 03:27

SSAP job SID6070053779193696 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 02:47

The entry "2qltA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 02:47

The entry "2qltA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Oct 2008 23:59

Retrieved PRC results for job ID SID9092267088863588 and inserted them into the database.

Domain scan prc cath by auto on 09 Oct 2008 23:58

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2qltA02

Update comment by auto on 08 Oct 2008 15:22

PRC job SID9092267088863588 is not yet finished.

Flow stage update by auto on 08 Oct 2008 15:12

The entry "2qltA02" has been submitted to the PRC webservice.

Prc cath submit by auto on 08 Oct 2008 15:12

The entry "2qltA02" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 14:47

Retrieved HMM(SAM) results for job ID SID4264458765768368 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 14:46

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2qltA02

Update comment by auto on 03 Oct 2008 17:53

HMM(SAM) job SID4264458765768368 is not yet finished.

Sam cath submit by auto on 03 Oct 2008 17:46

The entry "2qltA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 17:46

The entry "2qltA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 14:40

Unable to retrieve "2qltA02" HMM(SAM) results for job "SID7154843231579120"

Update comment by auto on 03 Oct 2008 00:22

HMM(SAM) job SID7154843231579120 is not yet finished.

Flow stage update by auto on 03 Oct 2008 00:06

The entry "2qltA02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 03 Oct 2008 00:06

The entry "2qltA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 20:56

Unable to retrieve "2qltA02" HMM(SAM) results for job "SID8688341698979820"

Update comment by auto on 02 Oct 2008 18:15

HMM(SAM) job SID8688341698979820 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 18:03

The entry "2qltA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 18:03

The entry "2qltA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 15:03

Unable to retrieve "2qltA02" HMM(SAM) results for job "SID1467797474756288"

Update comment by auto on 02 Oct 2008 12:01

HMM(SAM) job SID1467797474756288 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 11:51

The entry "2qltA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 11:51

The entry "2qltA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 09:22

Unable to retrieve "2qltA02" HMM(SAM) results for job "SID5059119375720416"

Update comment by auto on 02 Oct 2008 03:35

HMM(SAM) job SID5059119375720416 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 03:05

The entry "2qltA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 03:05

The entry "2qltA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 00:55

Retrieved "2qltA02" CATHEDRAL results for job ID SID6024280774081957 and inserted them into the database.

Domain scan cathedral cath by auto on 02 Oct 2008 00:54

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 156 results for 2qltA02

Update comment by auto on 29 Sep 2008 04:09

"2qltA02" CATHEDRAL job SID6024280774081957 is not yet finished.

Flow stage update by auto on 29 Sep 2008 03:54

The entry "2qltA02" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 29 Sep 2008 03:54

The entry "2qltA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 28 Sep 2008 20:38

Giving up on "2qltA02" CATHEDRAL job SID8623610864041280 because submission time of Mon Sep 22 18:53:51 2008 is more than 518400 seconds older than current time (Sun Sep 28 20:38:26 2008).

Update comment by auto on 22 Sep 2008 19:07

"2qltA02" CATHEDRAL job SID8623610864041280 is not yet finished.

Flow stage update by auto on 22 Sep 2008 18:53

The entry "2qltA02" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 22 Sep 2008 18:53

The entry "2qltA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Sep 2008 15:30

Giving up on "2qltA02" CATHEDRAL job SID4826845267820752 because submission time of Tue Sep 16 14:55:29 2008 is more than 518400 seconds older than current time (Mon Sep 22 15:30:29 2008).

Update comment by auto on 16 Sep 2008 15:09

"2qltA02" CATHEDRAL job SID4826845267820752 is not yet finished.

Cathedral cath submit by auto on 16 Sep 2008 14:55

The entry "2qltA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 16 Sep 2008 14:55

The entry "2qltA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 16 Sep 2008 14:32

ScanList with 11996 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qltA02.scanlist" for "2qltA02"

Write scan list by auto on 16 Sep 2008 14:32

Writing ScanList containing 11996 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qltA02.scanlist" for domain "2qltA02"

Update comment by auto on 16 Sep 2008 11:22

Waiting for 27 new domains (example : 2qwvB00) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 22:07

Waiting for 40 new domains (example : 2honA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 17:28

Waiting for 77 new domains (example : 2o6iA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 15:20

Waiting for 114 new domains (example : 2r7bA02) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 11:23

Waiting for 163 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 09:59

Waiting for 246 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 03:26

Waiting for 269 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 23:23

Waiting for 305 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 21:06

Waiting for 360 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 17:36

Waiting for 411 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Flow stage update by auto on 14 Sep 2008 17:34

No satisfactory AssignClose result found.

Flow stage update by auto on 14 Sep 2008 17:11

No in_process hits for Domain "2qltA02" ready to be processed

Flow stage update by auto on 14 Sep 2008 17:11

NW result present for Domain "2qltA02"

Flow stage update by auto on 11 Sep 2008 11:06

All required files are present for Domain "2qltA02"

Flow stage update by auto on 10 Sep 2008 17:44

Beginning processing for Domain "2qltA02"

Insertion by cuff on 10 Sep 2008 12:15

nice chopping