CATH Domain: 2qltA01 XML data for domain: 2qltA01

Molscript image for 2qltA01
2qltA01
PDB coordinates for domain 2qltA01

PDB 2qlt, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.1000 Gene3D
3.40.50.1000.19
3.40.50.1000.19.1
3.40.50.1000.19.1.1
3.40.50.1000.19.1.1.1
3.40.50.1000.19.1.1.1.1

Segment boundaries for domain 2qltA01

Chopping figure for domain 2qltA01
DomainStart PDB ResidueStop PDB Residue
2qltA01 27 47
2qltA01 110 265
2qltA02 48 109

Structural Neighbourhood (17 entries)

There are 17 matching structural neighberhood comparisons for CATH ID 3.40.50.1000.19.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 17 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2fdrA01 85.97 Agrobacterium tumefaciens str. C58Putative uncharacterized protein 3.40.50.1000 150 18 82 3.11 3.77
2hszA01 84.92 Phosphoglycolate phosphatase [EC:3.1.3.18]Haemophilus somnus 129PTMetabolic pathwaysGlyoxylate and dicarboxylate metabolismPhosphoglycolate phosphatase 3.40.50.1000 148 20 85 2.82 3.30
3d6jA01 84.47 Phosphoglycolate phosphatase [EC:3.1.3.18]Putative haloacid dehalogenase-like hydrolaseBacteroides fragilis NCTC 9343Glyoxylate and dicarboxylate metabolismMetabolic pathways 3.40.50.1000 137 19 80 2.47 3.08
3e58B01 84.04 Streptococcus thermophilus LMG 18311Beta-phosphoglucomutase, putative 3.40.50.1000 136 20 77 2.78 3.60
2nyvA01 83.87 Phosphoglycolate phosphatase [EC:3.1.3.18]Glyoxylate and dicarboxylate metabolismMetabolic pathwaysAquifex aeolicusPhosphoglycolate phosphatase 3.40.50.1000 151 25 86 4.03 4.66
1te2A01 83.43 Fructose and mannose metabolismMetabolic pathwaysRiboflavin metabolismThiamine metabolismMetal ion binding 3.40.50.1000 141 20 81 3.97 4.85
2hdoA01 83.38 Phosphoglycolate phosphatase [EC:3.1.3.18]Lactobacillus plantarumMetabolic pathwaysGlyoxylate and dicarboxylate metabolismPhosphoglycolate phosphatase (Putative) 3.40.50.1000 134 18 78 2.37 3.02
1swvA01 83.22 Bacillus cereusPhosphonoacetaldehyde hydrolase 3.40.50.1000 178 18 83 3.52 4.23
2ah5A01 82.78 Glyoxylate and dicarboxylate metabolismMetabolic pathwaysPhosphoglycolate phosphatase [EC:3.1.3.18]Hydrolase, haloacid dehalogenase-like familyStreptococcus pneumoniae 3.40.50.1000 142 13 81 2.86 3.49
2fi1A01 81.87 Hydrolase, haloacid dehalogenase-like familyStreptococcus pneumoniae 3.40.50.1000 123 21 70 3.20 4.52
3ed5A01 81.43 Putative HAD-hydrolase yfnBBacillus subtilis2-haloacid dehalogenase [EC:3.8.1.2]1,2-Dichloroethane degradationGamma-Hexachlorocyclohexane degradation 3.40.50.1000 140 20 79 3.37 4.24
1zjjB01 81.25 4-nitrophenyl phosphatase [EC:3.1.3.41]Pyrococcus horikoshiiGamma-Hexachlorocyclohexane degradationPutative uncharacterized protein PH1952 3.40.50.1000 146 21 79 2.87 3.61
2ho4B01 80.79 Mus musculusHaloacid dehalogenase-like hydrolase domain-containing protein 2 3.40.50.1000 159 15 82 3.41 4.14
2hx1A01 80.75 Cytophaga hutchinsonii ATCC 33406Possible sugar phosphatase, HAD superfamily 3.40.50.1000 155 14 80 3.41 4.26
2b0cA01 78.98 Phosphatase yihXGlucose-1-phosphatase activityPutative hydrolase of the HAD superfamilyEscherichia coli K-12 3.40.50.1000 133 14 75 3.51 4.65
1wpgA04 78.24 Calcium ion bindingATP catabolic processER-Golgi intermediate compartmentCalcium-transporting ATPase activitySarcoplasmic/endoplasmic reticulum calcium ATPase 1 3.40.50.1000 156 7 71 3.07 4.30
1nf2A01 77.62 Thermotoga maritimaPutative uncharacterized protein 3.40.50.1000 161 11 78 3.05 3.86
Displaying entries 1 to 17 (page 1 of 1)


Domain ATOM Sequence

>pdb|2qltA01
KPLSLKINAALFDVDGTIIISHSIEVPGAVKLCNALNALPKEKWAVATSGTRDMAKKWFDILKIKRPEYFITANDVKQGK
PHPEPYLKGRNGLGFPINEQDPSKSKVVVFEDAPAGIAAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGEYN
AETDEVELIFDDYLYAK    

Domain COMBS Sequence

>pdb|2qltA01
KPLSLKINAALFDVDGTIIISHSIEVPGAVKLCNALNALPKEKWAVATSGTRDMAKKWFDILKIKRPEYFITANDVKQGK
PHPEPYLKGRNGLGFPINEQDPSKSKVVVFEDAPAGIAAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGEYN
AETDEVELIFDDYLYAK    

Domain History Events (73)

Domain assigned by cuff on 06 Jan 2009 15:08

same superfamily

Domain assignment manual match h by cuff on 06 Jan 2009 15:07

homology match

Homcheck allotment by cuff on 06 Jan 2009 15:05

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 06 Jan 2009 15:05

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Oct 2008 21:46

Domain "2qltA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Oct 2008 21:46

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qltA01

Flow stage update by auto on 15 Oct 2008 21:26

Retrieved PRC_PFAMCATH results for job ID SID5345762448028320 and results inserted.

Domain scan prc pfamcath by auto on 15 Oct 2008 21:25

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 323 results for 2qltA01

Update comment by auto on 14 Oct 2008 21:06

PRC_PFAMCATH job SID5345762448028320 is not yet finished.

Flow stage update by auto on 14 Oct 2008 21:00

The entry "2qltA01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 14 Oct 2008 21:00

The entry "2qltA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 14 Oct 2008 20:44

Retrieved SSAP results for job ID SID8492316737760800 and results inserted.

Domain scan ssap cath by auto on 14 Oct 2008 20:42

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1632 results for 2qltA01

Update comment by auto on 10 Oct 2008 03:27

SSAP job SID8492316737760800 is not yet finished.

Flow stage update by auto on 10 Oct 2008 02:47

The entry "2qltA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 10 Oct 2008 02:47

The entry "2qltA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Oct 2008 23:58

Retrieved PRC results for job ID SID9959174779600686 and inserted them into the database.

Domain scan prc cath by auto on 09 Oct 2008 23:57

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 52 results for 2qltA01

Update comment by auto on 08 Oct 2008 15:22

PRC job SID9959174779600686 is not yet finished.

Prc cath submit by auto on 08 Oct 2008 15:12

The entry "2qltA01" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 15:12

The entry "2qltA01" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 14:46

Retrieved HMM(SAM) results for job ID SID4802757703578246 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 14:46

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 34 results for 2qltA01

Update comment by auto on 03 Oct 2008 17:52

HMM(SAM) job SID4802757703578246 is not yet finished.

Sam cath submit by auto on 03 Oct 2008 17:46

The entry "2qltA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 17:46

The entry "2qltA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 14:40

Unable to retrieve "2qltA01" HMM(SAM) results for job "SID3008413718762016"

Update comment by auto on 03 Oct 2008 00:22

HMM(SAM) job SID3008413718762016 is not yet finished.

Sam cath submit by auto on 03 Oct 2008 00:06

The entry "2qltA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 00:06

The entry "2qltA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 20:56

Unable to retrieve "2qltA01" HMM(SAM) results for job "SID5454791977906016"

Update comment by auto on 02 Oct 2008 18:15

HMM(SAM) job SID5454791977906016 is not yet finished.

Flow stage update by auto on 02 Oct 2008 18:03

The entry "2qltA01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 02 Oct 2008 18:03

The entry "2qltA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 15:03

Unable to retrieve "2qltA01" HMM(SAM) results for job "SID6281311359999744"

Update comment by auto on 02 Oct 2008 12:01

HMM(SAM) job SID6281311359999744 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 11:51

The entry "2qltA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 11:51

The entry "2qltA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 09:22

Unable to retrieve "2qltA01" HMM(SAM) results for job "SID4901762905762936"

Update comment by auto on 02 Oct 2008 03:35

HMM(SAM) job SID4901762905762936 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 03:05

The entry "2qltA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 03:05

The entry "2qltA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 00:54

Retrieved "2qltA01" CATHEDRAL results for job ID SID4131055398219766 and inserted them into the database.

Domain scan cathedral cath by auto on 02 Oct 2008 00:52

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 462 results for 2qltA01

Update comment by auto on 29 Sep 2008 04:09

"2qltA01" CATHEDRAL job SID4131055398219766 is not yet finished.

Cathedral cath submit by auto on 29 Sep 2008 03:54

The entry "2qltA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 29 Sep 2008 03:54

The entry "2qltA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 28 Sep 2008 20:38

Giving up on "2qltA01" CATHEDRAL job SID9259806885049520 because submission time of Mon Sep 22 18:53:45 2008 is more than 518400 seconds older than current time (Sun Sep 28 20:38:22 2008).

Update comment by auto on 22 Sep 2008 19:07

"2qltA01" CATHEDRAL job SID9259806885049520 is not yet finished.

Cathedral cath submit by auto on 22 Sep 2008 18:53

The entry "2qltA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Sep 2008 18:53

The entry "2qltA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Sep 2008 15:30

Giving up on "2qltA01" CATHEDRAL job SID3913290543340160 because submission time of Tue Sep 16 14:55:24 2008 is more than 518400 seconds older than current time (Mon Sep 22 15:30:25 2008).

Update comment by auto on 16 Sep 2008 15:09

"2qltA01" CATHEDRAL job SID3913290543340160 is not yet finished.

Cathedral cath submit by auto on 16 Sep 2008 14:55

The entry "2qltA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 16 Sep 2008 14:55

The entry "2qltA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 16 Sep 2008 14:32

ScanList with 11996 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qltA01.scanlist" for "2qltA01"

Write scan list by auto on 16 Sep 2008 14:32

Writing ScanList containing 11996 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qltA01.scanlist" for domain "2qltA01"

Update comment by auto on 16 Sep 2008 11:22

Waiting for 27 new domains (example : 2qwvB00) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 22:07

Waiting for 40 new domains (example : 2honA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 17:28

Waiting for 77 new domains (example : 2o6iA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 15:20

Waiting for 114 new domains (example : 2r7bA02) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 11:23

Waiting for 163 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 09:59

Waiting for 246 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 03:26

Waiting for 269 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 23:23

Waiting for 305 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 21:06

Waiting for 360 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 17:36

Waiting for 411 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Flow stage update by auto on 14 Sep 2008 17:34

No satisfactory AssignClose result found.

Flow stage update by auto on 14 Sep 2008 17:11

No in_process hits for Domain "2qltA01" ready to be processed

Flow stage update by auto on 14 Sep 2008 17:11

NW result present for Domain "2qltA01"

Flow stage update by auto on 11 Sep 2008 11:06

All required files are present for Domain "2qltA01"

Flow stage update by auto on 10 Sep 2008 17:44

Beginning processing for Domain "2qltA01"

Insertion by cuff on 10 Sep 2008 12:15

nice chopping