Domain assigned by cuff on 06 Jan 2009 15:08
same superfamily
| CATH Code | Level Description | Links |
|---|---|---|
3
| Alpha Beta | |
3.40
| 3-Layer(aba) Sandwich | |
3.40.50
| Rossmann fold | |
3.40.50.1000
| Gene3D | |
3.40.50.1000.19
| ||
3.40.50.1000.19.1
| ||
3.40.50.1000.19.1.1
| ||
3.40.50.1000.19.1.1.1
| ||
3.40.50.1000.19.1.1.1.1
|
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2qltA01 | 27 | 47 |
| 2qltA01 | 110 | 265 |
| 2qltA02 | 48 | 109 |
There are 17 matching structural neighberhood comparisons for CATH ID 3.40.50.1000.19.1.1.1.1 (SIMAX score < 5)
>pdb|2qltA01 KPLSLKINAALFDVDGTIIISHSIEVPGAVKLCNALNALPKEKWAVATSGTRDMAKKWFDILKIKRPEYFITANDVKQGK PHPEPYLKGRNGLGFPINEQDPSKSKVVVFEDAPAGIAAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGEYN AETDEVELIFDDYLYAK
same superfamily
homology match
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "2qltA01" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qltA01
Retrieved PRC_PFAMCATH results for job ID SID5345762448028320 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 323 results for 2qltA01
PRC_PFAMCATH job SID5345762448028320 is not yet finished.
The entry "2qltA01" has been submitted to the PRC_PFAMCATH webservice.
The entry "2qltA01" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID8492316737760800 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1632 results for 2qltA01
SSAP job SID8492316737760800 is not yet finished.
The entry "2qltA01" has been submitted to the SSAP webservice.
The entry "2qltA01" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID9959174779600686 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 52 results for 2qltA01
PRC job SID9959174779600686 is not yet finished.
The entry "2qltA01" has been submitted to the PRC webservice.
The entry "2qltA01" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID4802757703578246 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 34 results for 2qltA01
HMM(SAM) job SID4802757703578246 is not yet finished.
The entry "2qltA01" has been submitted to the HMM (SAM) webservice.
The entry "2qltA01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2qltA01" HMM(SAM) results for job "SID3008413718762016"
HMM(SAM) job SID3008413718762016 is not yet finished.
The entry "2qltA01" has been submitted to the HMM (SAM) webservice.
The entry "2qltA01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2qltA01" HMM(SAM) results for job "SID5454791977906016"
HMM(SAM) job SID5454791977906016 is not yet finished.
The entry "2qltA01" has been submitted to the HMM (SAM) webservice.
The entry "2qltA01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2qltA01" HMM(SAM) results for job "SID6281311359999744"
HMM(SAM) job SID6281311359999744 is not yet finished.
The entry "2qltA01" has been submitted to the HMM (SAM) webservice.
The entry "2qltA01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2qltA01" HMM(SAM) results for job "SID4901762905762936"
HMM(SAM) job SID4901762905762936 is not yet finished.
The entry "2qltA01" has been submitted to the HMM (SAM) webservice.
The entry "2qltA01" has been submitted to the HMM (SAM) webservice.
Retrieved "2qltA01" CATHEDRAL results for job ID SID4131055398219766 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 462 results for 2qltA01
"2qltA01" CATHEDRAL job SID4131055398219766 is not yet finished.
The entry "2qltA01" has been submitted to the CATHEDRAL webservice.
The entry "2qltA01" has been submitted to the CATHEDRAL webservice.
Giving up on "2qltA01" CATHEDRAL job SID9259806885049520 because submission time of Mon Sep 22 18:53:45 2008 is more than 518400 seconds older than current time (Sun Sep 28 20:38:22 2008).
"2qltA01" CATHEDRAL job SID9259806885049520 is not yet finished.
The entry "2qltA01" has been submitted to the CATHEDRAL webservice.
The entry "2qltA01" has been submitted to the CATHEDRAL webservice.
Giving up on "2qltA01" CATHEDRAL job SID3913290543340160 because submission time of Tue Sep 16 14:55:24 2008 is more than 518400 seconds older than current time (Mon Sep 22 15:30:25 2008).
"2qltA01" CATHEDRAL job SID3913290543340160 is not yet finished.
The entry "2qltA01" has been submitted to the CATHEDRAL webservice.
The entry "2qltA01" has been submitted to the CATHEDRAL webservice.
ScanList with 11996 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qltA01.scanlist" for "2qltA01"
Writing ScanList containing 11996 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qltA01.scanlist" for domain "2qltA01"
Waiting for 27 new domains (example : 2qwvB00) to be processed so that they can be scanned against too.
Waiting for 40 new domains (example : 2honA01) to be processed so that they can be scanned against too.
Waiting for 77 new domains (example : 2o6iA01) to be processed so that they can be scanned against too.
Waiting for 114 new domains (example : 2r7bA02) to be processed so that they can be scanned against too.
Waiting for 163 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Waiting for 246 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Waiting for 269 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Waiting for 305 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Waiting for 360 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
Waiting for 411 new domains (example : 2c00A01) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "2qltA01" ready to be processed
NW result present for Domain "2qltA01"
All required files are present for Domain "2qltA01"
Beginning processing for Domain "2qltA01"
nice chopping