CATH Domain: 2qlcA00 XML data for domain: 2qlcA00

Molscript image for 2qlcA00
2qlcA00
PDB coordinates for domain 2qlcA00

PDB 2qlc, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.140 Cytidine Deaminase; domain 2
3.40.140.10 Cytidine Deaminase, domain 2 Gene3D
3.40.140.10.11
3.40.140.10.11.1
3.40.140.10.11.1.1
3.40.140.10.11.1.1.1
3.40.140.10.11.1.1.1.1

[top]
Segment boundaries for domain 2qlcA00

Chopping figure for domain 2qlcA00
DomainStart PDB ResidueStop PDB Residue
2qlcA00 1 126

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2qlcA00
MNLKVKGARDVFEYMKGRIPDETKEHLFVLFLSTKNQILRHETITIGTLTASLIHPREIFKAAIRESAHSIILVHNHPSG
DVQPSNADKQVTSILKKAGDLLQIELLDHVIVGNNDWFSFRDHALL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qlcA00
MNLKVKGARDVFEYMKGRIPDETKEHLFVLFLSTKNQILRHETITIGTLTASLIHPREIFKAAIRESAHSIILVHNHPSG
DVQPSNADKQVTSILKKAGDLLQIELLDHVIVGNNDWFSFRDHALL
BLAST against CATH

[top]
Domain History Events (14)

Domain assigned by auto on 06 Jan 2009 16:05

Assigning to "3.40.140.10" based on similarity with "2qlcD00"

Flow stage update by auto on 06 Jan 2009 16:03

No in_process hits for Domain "2qlcA00" ready to be processed

Update comment by auto on 06 Jan 2009 16:00

Domain "2qlcA00" hits Domain "2qlcD00" (100% over 100%) which is currently in process

Update comment by auto on 06 Jan 2009 15:56

Domain "2qlcA00" hits Domain "2qlcF00" (100% over 100%) which is currently in process

Update comment by auto on 06 Jan 2009 15:53

Domain "2qlcA00" hits Domain "2qlcE00" (100% over 100%) which is currently in process

Update comment by auto on 06 Jan 2009 15:49

Domain "2qlcA00" hits Domain "2qlcB00" (100% over 100%) which is currently in process

Update comment by auto on 06 Jan 2009 15:42

Domain "2qlcA00" hits Domain "2qlcC00" (100% over 100%) which is currently in process

Update comment by auto on 06 Jan 2009 15:24

Domain "2qlcA00" hits Domain "2qlcG00" (100% over 100%) which is currently in process

Update comment by auto on 23 Sep 2008 17:15

Domain "2qlcA00" hits Domain "2qlcH00" (100% over 100%) which is currently in process

Flow stage update by auto on 23 Sep 2008 17:13

Domain "2qlcA00" hits Domain "2qlcH00" (100% over 100%) which is currently in process

Flow stage update by auto on 23 Sep 2008 17:13

NW result present for Domain "2qlcA00"

Flow stage update by auto on 23 Sep 2008 08:17

All required files are present for Domain "2qlcA00"

Flow stage update by auto on 22 Sep 2008 15:12

Beginning processing for Domain "2qlcA00"

Insertion by auto on 22 Sep 2008 14:24

Final ChopClose added based on similarity with "2qlcC"