CATH Domain: 2qjyB02 XML data for domain: 2qjyB02

Molscript image for 2qjyB02
2qjyB02
PDB coordinates for domain 2qjyB02

PDB 2qjy, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.5 Single alpha-helices involved in coiled-coils or other helix-helix interfaces
1.20.5.100 Gene3D
1.20.5.100.3
1.20.5.100.3.1
1.20.5.100.3.1.1
1.20.5.100.3.1.1.1
1.20.5.100.3.1.1.1.1

[top]
Segment boundaries for domain 2qjyB02

Chopping figure for domain 2qjyB02
DomainStart PDB ResidueStop PDB Residue
2qjyB01 1 221
2qjyB02 222 256

Structural Neighbourhood (133 entries)

There are 133 matching structural neighberhood comparisons for CATH ID 1.20.5.100.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 133 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2qjpB02 98.31 Rhodobacter sphaeroidesCytochrome c1 1.20.5.100 35 100 100 0.24 0.24
2p7jB01 88.95 Vibrio parahaemolyticusPutative sensory box/GGDEF family protein 1.20.5.170 39 5 87 1.96 2.25
2hr3A01 88.48 Probable transcriptional regulatorPseudomonas aeruginosa 1.20.5.420 30 10 82 0.94 1.13
1tiiC00 88.04 Heat-labile enterotoxin IIB, A chainEscherichia coli 1.20.5.200 36 8 86 1.72 2.00
2h8pD00 87.70 1.20.5.110 43 14 81 1.43 1.76
2k9jB00 87.39 Positive regulation of endothelial cell migrationPlatelet-derived growth factor receptor bindingPositive regulation of endothelial cell proliferationActivation of protein kinase activityRegulation of bone resorption 1.20.5.100 43 14 81 1.61 1.98
1a2xB00 87.32 Troponin I, fast skeletal muscleTroponin T bindingOryctolagus cuniculus 1.20.5.420 31 3 80 1.29 1.61
1vf5C03 86.81 Mastigocladus laminosusApocytochrome f 1.20.5.700 32 9 85 1.69 1.97
1g2cB00 86.74 Human respiratory syncytial virus strain RSS-2Fusion glycoprotein F0 1.20.5.170 40 14 87 2.25 2.57
1hj0A00 86.44 Bos taurusThymosin beta-10 1.20.5.520 41 14 85 3.94 4.62
1nkzB00 86.18 Rhodoblastus acidophilusLight-harvesting protein B-800/850 beta chain 1.20.5.250 41 2 85 2.53 2.96
1jekA00 86.18 Visna/maedi virus EV1 KV1772Envelope glycoprotein gp160 1.20.5.440 40 2 82 1.96 2.38
1owaA01 86.15 Structural constituent of cytoskeletonSpectrinHomo sapiensSpectrin-associated cytoskeletonActin filament organization 1.20.5.170 32 3 82 2.44 2.94
1ybkA00 86.06 TetrabrachionStaphylothermus marinus 1.20.5.1060 52 2 67 1.37 2.04
1n2dC00 85.68 Mating projection tipGolgi inheritanceActin filament bindingVesicle-mediated transportMyosin-2 1.20.5.190 48 11 68 1.11 1.61
1dipB01 85.10 Sus scrofaTSC22 domain family protein 3 1.20.5.490 45 5 75 2.65 3.51
1fdoA05 85.03 Methane metabolismMetabolic pathwaysGlyoxylate and dicarboxylate metabolismFormate dehydrogenase HFormate dehydrogenase, alpha subunit [EC:1.2.1.2] 1.20.5.460 27 14 74 1.37 1.84
1junA00 84.87 Pathways in cancerChagas diseaseNeurotrophin signaling pathwayB cell receptor signaling pathwayT cell receptor signaling pathway 1.20.5.170 43 11 67 1.39 2.06
1hf9A00 84.78 Protein homodimerization activityNegative regulation of hydrolase activityATPase inhibitor activityBos taurusATPase binding 1.20.5.500 41 5 85 2.59 3.03
1gl2A00 84.78 Rattus norvegicusProtein complex assemblyVesicle-associated membrane protein 8Cellular membrane fusionVesicle-associated membrane protein 8 1.20.5.110 53 5 66 1.08 1.64
2zxeB01 84.69 1.20.5.170 35 11 62 0.57 0.91
2k1aA00 84.63 Integrin alpha 2BIdentical protein bindingPathways in cancerHematopoietic cell lineageDilated cardiomyopathy 1.20.5.930 42 8 80 2.59 3.20
2o1kA00 84.27 Simian rotavirus A/SA11-bothNon-structural glycoprotein 4 1.20.5.430 42 5 73 1.89 2.56
2jwaA00 84.24 Heart developmentTransmembrane receptor protein tyrosine kinase signaling pathwayCell proliferationPositive regulation of cell adhesionProtein heterodimerization activity 1.20.5.100 44 17 79 3.83 4.81
1m56D00 84.01 Rhodobacter sphaeroidesAa3-type cytochrome c oxidase subunit IV 1.20.5.160 42 11 66 0.92 1.38
3kpeA00 83.90 Fusion glycoprotein F0Human respiratory syncytial virus A2 1.20.5.300 47 11 70 1.96 2.79
1kqfB03 83.84 Two-component systemMetabolic pathwaysGlyoxylate and dicarboxylate metabolismMethane metabolismFormate dehydrogenase activity 1.20.5.480 44 20 79 3.41 4.29
2qjyC01 83.68 Oxidative phosphorylationMetabolic pathwaysRhodobacter sphaeroidesUbiquinol-cytochrome c reductase iron-sulfur subunitUbiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2] 1.20.5.510 33 12 71 2.88 4.03
1nhlA00 83.58 Vesicle targetingAzurophil granuleCellular membrane fusionSynaptosomal-associated protein 23Protein binding 1.20.5.110 52 8 65 1.13 1.73
3effK02 83.54 Streptomyces lividansVoltage-gated potassium channel 1.20.5.440 45 11 77 2.32 2.98
1xrdA01 83.50 Light-harvesting complex 1 alpha chainRhodospirillum rubrumLight-harvesting protein B-870 alpha chain 1.20.5.890 43 8 67 1.17 1.73
1ik7A00 83.32 Regulation of proteolysisProtein domain specific bindingHemocyte proliferationPlasma membraneZygotic specification of dorsal/ventral axis 1.20.5.530 52 11 67 1.50 2.23
1kmiZ01 83.19 Bacterial chemotaxisChemotaxis protein cheZProtein bindingChemotaxis protein CheZEscherichia coli K-12 1.20.5.590 30 6 65 1.19 1.81
2oarE02 82.99 Large conductance mechanosensitive channel, MscL familyLarge-conductance mechanosensitive channelMycobacterium tuberculosis H37Ra 1.20.5.220 22 4 62 1.25 1.99
2p10B02 82.98 Mesorhizobium lotiMll9387 protein 1.20.5.460 26 0 71 1.84 2.58
1omiA02 82.85 Listeria monocytogenesListeriolysin regulatory protein 1.20.5.460 27 3 60 0.81 1.35
1e5wA04 82.61 Leukocyte migrationReceptor bindingCytoskeletonMembrane to membrane dockingNucleolus 1.20.5.450 55 11 63 1.27 2.00
1pfiA00 82.57 Pseudomonas phage Pf1Capsid protein G8P 1.20.5.230 46 8 65 1.54 2.36
2pjuD03 82.56 Positive regulation of gene-specific transcriptionPropionate catabolism operon regulatory proteinNegative regulation of gene-specific transcriptionEscherichia coli K-12Specific transcriptional repressor activity 1.20.5.170 41 11 82 3.61 4.35
2v7qJ00 82.53 Protein homodimerization activityNegative regulation of hydrolase activityATPase inhibitor activityBos taurusCalmodulin binding 1.20.5.500 43 2 79 3.77 4.77
1u57A00 82.47 Human immunodeficiency virus type 1 lw12.3 isolateGag polyprotein 1.20.5.760 48 11 70 2.21 3.12
1slqF02 82.27 Outer capsid protein VP4Rhesus rotavirus 1.20.5.170 32 12 62 1.01 1.61
2p1jB02 82.14 Thermotoga maritimaPyrimidine metabolismDNA replicationPurine metabolismMetabolic pathways 1.20.5.140 26 7 74 3.18 4.28
2k9yA00 82.14 ApoptosisIntegral to plasma membraneEphrin type-A receptor 2Homo sapiensEph receptor A2 [EC:2.7.10.1] 1.20.5.510 41 8 68 1.67 2.45
1czqA00 81.94 1.20.5.170 45 14 64 1.58 2.45
1gmjD00 81.91 Negative regulation of hydrolase activityProtein homodimerization activityATPase inhibitor activityBos taurusCalmodulin binding 1.20.5.500 56 2 62 1.52 2.43
1s3jB01 81.86 Bacillus subtilisUncharacterized HTH-type transcriptional regulator yusO 1.20.5.420 30 10 77 2.52 3.27
1gl2D00 81.74 Syntaxin-8Rattus norvegicusProtein bindingSyntaxin 8SNARE interactions in vesicular transport 1.20.5.110 54 11 64 1.75 2.70
1m7lA00 81.61 Negative regulation of T cell proliferationProtein bindingInnate immune responseLung alveolus developmentEndocytic vesicle 1.20.5.360 40 5 87 3.70 4.23
1ci6A00 81.61 Positive regulation of transcription from RNA polymerase II promoterCellular amino acid metabolic processNeurotrophin signaling pathwayActivating transcription factor 4Sequence-specific DNA binding transcription factor activity 1.20.5.170 56 8 62 1.64 2.62
2p1jA02 81.59 Thermotoga maritimaPyrimidine metabolismDNA replicationPurine metabolismMetabolic pathways 1.20.5.140 26 23 62 1.45 2.31
2zjsE00 81.30 Protein exportBacterial secretion systemThermus thermophilus HB8Preprotein translocase subunit secEPreprotein translocase subunit SecE 1.20.5.1030 46 8 76 2.15 2.83
1go9A00 81.15 1.20.5.480 39 5 64 1.45 2.26
2r44A01 81.14 Cytophaga hutchinsonii ATCC 33406MoxR-like ATPase [EC:3.6.3.-]Putative uncharacterized protein 1.20.5.420 26 7 74 2.05 2.76
1urqC00 81.10 SNARE interactions in vesicular transportSleepRattus norvegicusRegulation of synaptogenesisVoltage-gated potassium channel complex 1.20.5.110 68 11 51 0.88 1.71
1jcdB00 81.08 Peptidoglycan bindingMurein lipoproteinMajor outer membrane lipoprotein LppProtein bindingEscherichia coli K-12 1.20.5.190 52 11 67 2.19 3.25
1gd2F00 81.05 NuA4 histone acetyltransferase complexFungal AP-1-like factorResponse to hydrogen peroxideResponse to methylglyoxalCellular response to oxidative stress 1.20.5.170 64 14 54 1.00 1.83
1be3K00 80.93 Cardiac muscle contractionCytochrome b-c1 complex subunit 10Oxidative phosphorylationParkinson's diseaseAlzheimer's disease 1.20.5.220 22 13 54 0.66 1.22
2ifoA00 80.22 Xanthomonas phage XfCapsid protein G8P 1.20.5.230 46 11 67 2.16 3.21
1h8bB00 80.17 TitinOryctolagus cuniculus 1.20.5.510 23 13 65 2.30 3.50
1kv4A00 80.14 Moricin-1Bombyx mori 1.20.5.750 42 11 76 2.75 3.61
1ozhA03 80.13 Acetolactate synthase, catabolicKlebsiella pneumoniae 1.20.5.740 24 8 62 2.46 3.91
1dh3A00 80.11 Positive regulation of multicellular organism growthLactationRegulation of cell sizeAxonogenesisMus musculus 1.20.5.170 55 14 63 2.56 4.02
2b9bA04 80.00 Simian virus 5 (strain W3)Fusion glycoprotein F0 1.20.5.1070 62 2 56 1.45 2.57
3e7kA00 79.98 Rattus norvegicusCalcium channel activityCalcium ion transportIntegral to membraneProtein binding 1.20.5.1010 54 2 61 1.91 3.13
1vl2A03 79.93 Thermotoga maritimaArginine and proline metabolismArgininosuccinate synthase [EC:6.3.4.5]Alanine, aspartate and glutamate metabolismArgininosuccinate synthase 1.20.5.470 32 6 91 4.04 4.42
1jocA01 79.82 Zinc ion bindingVesicle fusionMembrane fractionSynaptic vesicle to endosome fusionProtein homodimerization activity 1.20.5.390 60 8 58 1.70 2.91
1a02F00 79.74 Promoter bindingPathways in cancerChagas diseaseProto-oncogene protein c-fosB cell receptor signaling pathway 1.20.5.170 53 14 66 2.46 3.73
1kilE00 79.71 Complexin-1Syntaxin-1 bindingRattus norvegicusDendriteSynaptobrevin 2-SNAP-25-syntaxin-1a-complexin I complex 1.20.5.580 41 8 65 2.26 3.43
3c8vA04 79.53 Desulfovibrio desulfuricans subsp. desulfuricans str. G20Putative uncharacterized protein 1.20.5.510 19 5 54 0.69 1.27
1vl2B03 79.51 Thermotoga maritimaArginine and proline metabolismArgininosuccinate synthase [EC:6.3.4.5]Alanine, aspartate and glutamate metabolismArgininosuccinate synthase 1.20.5.470 30 6 85 3.08 3.59
1fs0E02 79.46 Oxidative phosphorylationMetabolic pathwaysATP synthase epsilon chainF-type H+-transporting ATPase subunit epsilon [EC:3.6.3.14]Escherichia coli K-12 1.20.5.440 38 8 50 0.61 1.22
3fwlA01 79.36 Peptidoglycan biosynthesisPenicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]Penicillin bindingPenicillin-binding protein 1BPeptidoglycan biosynthetic process 1.20.5.100 31 0 57 0.77 1.35
1gl2B00 79.32 Mus musculusSyntaxin-7 1.20.5.110 59 5 52 1.39 2.65
1ow6A01 79.02 Focal adhesion kinase 1Focal adhesionCytoskeletonIntegrin-mediated signaling pathwayHomo sapiens 1.20.5.540 30 3 54 2.08 3.83
2o01J01 78.74 Photosystem I reaction center subunit IXSpinacia oleracea 1.20.5.510 25 8 65 1.60 2.43
2qiwA02 78.62 Corynebacterium glutamicumPEP phosphonomutase and related enzymes 1.20.5.510 18 11 51 0.81 1.57
3efgA00 78.47 Xanthomonas campestris pv. campestrisSlyX proteinProtein slyX homolog 1.20.5.300 49 14 51 0.87 1.71
2i8dA02 77.90 Hypothetical proteinLactobacillus casei ATCC 334Putative uncharacterized protein 1.20.5.420 30 6 54 2.09 3.85
3bz1H01 77.71 PhotosynthesisThermosynechococcus elongatus BP-1Photosystem II PsbH proteinPhotosystem II reaction center protein HMetabolic pathways 1.20.5.880 51 11 54 2.06 3.75
1k04A01 77.68 Focal adhesion kinase 1Focal adhesionIntegrin-mediated signaling pathwayCytoskeletonHomo sapiens 1.20.5.540 38 2 50 1.84 3.68
1jnmA00 77.51 Pathways in cancerChagas diseaseNeurotrophin signaling pathwayB cell receptor signaling pathwayT cell receptor signaling pathway 1.20.5.170 56 2 51 1.46 2.82
1ci6B00 77.38 Mammary gland epithelial cell differentiationMammary gland epithelial cell proliferationCytoplasmProtein heterodimerization activitySequence-specific enhancer binding RNA polymerase II transcription factor activity 1.20.5.170 47 5 46 0.85 1.82
1piqA00 77.19 NucleusPositive regulation of RNA polymerase II transcriptional preinitiation complex assemblyGeneral control protein GCN4General control protein GCN4Specific RNA polymerase II transcription factor activity 1.20.5.170 31 0 45 0.31 0.68
1dd4D01 77.15 Thermotoga maritima50S ribosomal protein L7/L12 1.20.5.710 30 10 54 2.59 4.77
2qsiA02 76.97 Putative hydrogenase expression/formation protein hupGHydrogenase-1 operon protein HyaERhodopseudomonas palustris 1.20.5.510 27 3 54 2.69 4.96
1mqsB00 76.83 Vesicle fusionSyntaxin 5SNAP receptor activityER to Golgi vesicle-mediated transportRetrograde vesicle-mediated transport, Golgi to ER 1.20.5.460 26 3 48 1.03 2.12
1gu4A00 76.61 Transcription from RNA polymerase II promoterAcute-phase responseHomo sapiensCCAAT/enhancer-binding protein betaImmune response 1.20.5.170 65 8 53 2.39 4.44
1ic2B00 76.54 Gallus gallusTropomyosin alpha-1 chain 1.20.5.340 77 20 45 1.41 3.10
2e42A00 76.52 Transcription from RNA polymerase II promoterAcute-phase responseHomo sapiensCCAAT/enhancer-binding protein betaImmune response 1.20.5.170 65 8 53 2.41 4.48
1jthB00 76.37 Protein domain specific bindingMyosin head/neck bindingActomyosinRattus norvegicusProtein heterodimerization activity 1.20.5.110 67 8 43 0.65 1.50
1gk6B00 76.33 Positive regulation of RNA polymerase II transcriptional preinitiation complex assemblyIntermediate filamentVimentinCytosolPositive regulation of gene-specific transcription from RNA polymerase II promoter 1.20.5.170 52 11 50 1.33 2.66
1t6aA01 76.24 Geobacillus stearothermophilusRbstp2229 protein 1.20.5.850 43 2 46 1.45 3.12
1gk4C00 76.06 Cellular component movementProtein C-terminus bindingIntermediate filamentVimentinCytosol 1.20.5.170 70 14 50 1.89 3.78
1j1dB00 75.97 Response to calcium ionTroponin C bindingPositive regulation of ATPase activityActin bindingNegative regulation of ATPase activity 1.20.5.350 70 11 50 2.12 4.24
3cx5E01 75.86 Cytochrome b-c1 complex subunit Rieske, mitochondrialMitochondrial respiratory chain complex IIIOxidative phosphorylationMetabolic pathwaysAerobic respiration 1.20.5.270 55 5 58 2.86 4.92
2oarA02 75.66 Large conductance mechanosensitive channel, MscL familyLarge-conductance mechanosensitive channelMycobacterium tuberculosis H37Ra 1.20.5.220 17 5 42 0.46 1.07
1n7sB00 75.56 Protein domain specific bindingActomyosinMyosin head/neck bindingRattus norvegicusProtein binding, bridging 1.20.5.110 68 8 41 0.76 1.85
1n7sD00 75.40 SNARE interactions in vesicular transportSleepRattus norvegicusRegulation of synaptogenesisVoltage-gated potassium channel complex 1.20.5.110 66 0 53 2.02 3.81
1jmmA01 75.36 Major cell-surface adhesin PAcStreptococcus mutans 1.20.5.250 32 6 48 0.94 1.94
3b5nA00 75.34 Synaptobrevin homolog 1Vesicle fusionSNAP receptor activityPlasma membraneVesicle-associated membrane protein 4 1.20.5.110 61 8 49 1.71 3.48
1csbA01 75.34 Regulation of apoptosisLysosomeHomo sapiensCathepsin B [EC:3.4.22.1]Cathepsin B 1.20.5.170 42 2 50 1.40 2.80
1pl5A00 75.00 Chromatin silencing complexLoss of chromatin silencing involved in replicative cell agingChromatin silencingDouble-strand break repair via nonhomologous end joiningDouble-stranded DNA binding 1.20.5.730 75 5 45 1.76 3.88
1onvB00 74.85 CTD phosphatase activityProtein dephosphorylationHomo sapiensRNA polymerase II subunit A C-terminal domain phosphataseDNA-directed RNA polymerase activity 1.20.5.670 21 19 60 2.43 4.05
1svfC00 74.82 Simian virus 5 (strain W3)Fusion glycoprotein F0 1.20.5.300 62 2 43 1.26 2.89
1gl2C00 74.64 Mus musculusVesicle transport through interaction with t-SNAREs homolog 1BGolgi apparatusProtein binding 1.20.5.110 59 2 45 1.73 3.78
1n7sA00 74.58 SNARE interactions in vesicular transportVasopressin-regulated water reabsorptionRattus norvegicusProtein complex bindingVesicle-mediated transport 1.20.5.110 63 5 38 0.53 1.39
1l2pA00 74.29 Oxidative phosphorylationMetabolic pathwaysATP synthesis coupled proton transportAnchored to membraneF-type H+-transporting ATPase subunit b [EC:3.6.3.14] 1.20.5.620 61 14 37 0.58 1.54
1dp5B00 74.16 CytoplasmProtease A inhibitor 3Saccharomyces cerevisiaeVacuolar protein catabolic processProtein binding 1.20.5.140 31 12 42 0.63 1.47
1d66B02 74.07 Regulatory protein GAL4NucleusSequence-specific DNA binding transcription factor activityTranscription activator activityPositive regulation of transcription by galactose 1.20.5.640 15 6 42 0.56 1.31
1no4C00 74.03 Bacillus phage phi29Head morphogenesis protein 1.20.5.400 73 8 47 1.83 3.82
2wscH01 73.89 Photosystem I reaction center subunit VI, chloroplasticSpinacia oleracea 1.20.5.220 23 13 65 2.50 3.80
2wwwC01 73.60 Methylmalonic aciduria type A protein, mitochondrialHomo sapiensLAO/AO transport system kinase [EC:2.7.-.-] 1.20.5.170 52 2 44 1.33 3.01
3clqB01 73.46 Enterococcus faecalisPutative uncharacterized protein 1.20.5.220 24 8 42 0.52 1.21
1t3jA00 72.69 Mus musculusMitochondrial fusionMitofusin-1Protein binding 1.20.5.110 62 8 38 0.98 2.53
1mslA02 72.53 1.20.5.220 18 0 45 1.20 2.62
1pp9E01 72.47 Cytochrome b-c1 complex subunit Rieske, mitochondrialBos taurus 1.20.5.270 64 5 40 1.69 4.16
2zvoB00 71.86 Mus musculusNF-kappa-B essential modulatorActivation of NF-kappaB-inducing kinase activityB cell homeostasis 1.20.5.990 88 20 39 1.32 3.32
1k87A01 71.54 Arginine and proline metabolismMetabolic pathwaysAlanine, aspartate and glutamate metabolism1-pyrroline-5-carboxylate dehydrogenase activityBifunctional protein putA 1.20.5.550 52 11 34 0.40 1.16
1mkmA02 71.45 Thermotoga maritimaTranscriptional regulator, IclR family 1.20.5.640 14 7 40 0.64 1.60
3hd7B00 71.28 Myosin head/neck bindingActomyosinProtein domain specific bindingRattus norvegicusProtein heterodimerization activity 1.20.5.110 98 8 35 1.75 4.90
1fs0G02 71.17 Oxidative phosphorylationMetabolic pathwaysATP synthesis coupled proton transportATP synthase gamma chainF-type H+-transporting ATPase subunit gamma [EC:3.6.3.14] 1.10.287.80 89 2 32 0.84 2.58
1ik9B02 71.06 DNA ligation involved in DNA repairResponse to X-rayDNA-dependent protein kinase-DNA ligase 4 complexProtein C-terminus bindingDouble-strand break repair via nonhomologous end joining 1.20.5.370 83 8 42 1.62 3.84
1ox3A00 70.48 Enterobacteria phage T4Fibritin 1.20.5.320 108 8 32 1.26 3.89
2basA02 69.75 Bacillus subtilisUncharacterized EAL-domain containing protein ykuI 1.20.5.170 46 5 39 1.48 3.78
2gm6A01 69.70 Ralstonia eutropha JMP134Cysteine dioxygenase type I 1.20.5.440 38 2 47 1.96 4.14
1v54B01 69.58 Cardiac muscle contractionParkinson's diseaseOxidative phosphorylationCytochrome c oxidase subunit 2Alzheimer's disease 1.10.287.90 90 5 33 1.53 4.59
2pp6A01 69.42 Salmonella enterica subsp. enterica serovar TyphimuriumGifsy-2 prophage ATP-binding sugar transporter-like protein 1.20.5.110 21 14 42 1.70 3.97
1xvhA02 69.41 Extracellular matrix-binding protein ebhStaphylococcus aureus subsp. aureus MW2 1.20.5.420 55 5 32 1.17 3.58
2w83C00 69.10 Homo sapiensIntegral to membraneC-Jun-amino-terminal kinase-interacting protein 4SpermatogenesisPositive regulation of cell migration 1.20.5.1000 67 11 29 0.59 1.98
3b5nJ00 68.60 Cellular membrane fusionSNARE complexPhosphatidylinositol-3,5-bisphosphate bindingSyntaxin 1B/2/3Prospore membrane 1.20.5.110 64 2 31 0.82 2.62
3ii6A02 68.01 DNA ligation involved in DNA repairProtein C-terminus bindingDNA-dependent protein kinase-DNA ligase 4 complexResponse to X-rayDouble-strand break repair via nonhomologous end joining 1.20.5.370 58 8 34 1.01 2.93
1cunA01 65.31 Spectrin alpha chain, brainGallus gallusSpectrin alpha 1.20.58.60 102 5 24 0.63 2.57
[1]
Displaying entries 1 to 133 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qjyB02
KLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qjyB02
KLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVKGKKKTNVHHHHHH
BLAST against CATH

[top]
Domain History Events (27)

Domain assigned by auto on 04 Aug 2008 15:46

Assigning to "1.20.5.100" based on similarity with "2fynB02"

Flow stage update by auto on 04 Aug 2008 15:45

No in_process hits for Domain "2qjyB02" ready to be processed

Update comment by auto on 04 Aug 2008 15:42

Domain "2qjyB02" hits Domain "2qjyQ02" (100% over 100%) which is currently in process

Update comment by auto on 04 Aug 2008 15:34

Domain "2qjyB02" hits Domain "2qjpB02" (100% over 72.9166666666667%) which is currently in process

Update comment by auto on 04 Aug 2008 15:32

Domain "2qjyB02" hits Domain "2qjpE02" (100% over 72.9166666666667%) which is currently in process

Update comment by auto on 04 Aug 2008 15:29

Domain "2qjyB02" hits Domain "2qjpK02" (100% over 72.9166666666667%) which is currently in process

Update comment by auto on 04 Aug 2008 15:27

Domain "2qjyB02" hits Domain "2qjpH02" (100% over 72.9166666666667%) which is currently in process

Update comment by auto on 04 Aug 2008 15:17

Domain "2qjyB02" hits Domain "2qjkQ02" (100% over 72.9166666666667%) which is currently in process

Update comment by auto on 04 Aug 2008 15:07

Domain "2qjyB02" hits Domain "2qjkN02" (100% over 72.9166666666667%) which is currently in process

Update comment by auto on 04 Aug 2008 14:56

Domain "2qjyB02" hits Domain "2qjkK02" (100% over 72.9166666666667%) which is currently in process

Update comment by auto on 04 Aug 2008 14:45

Domain "2qjyB02" hits Domain "2qjkH02" (100% over 72.9166666666667%) which is currently in process

Update comment by auto on 04 Aug 2008 14:35

Domain "2qjyB02" hits Domain "2qjkE02" (100% over 72.9166666666667%) which is currently in process

Update comment by auto on 04 Aug 2008 14:22

Domain "2qjyB02" hits Domain "2qjkB02" (100% over 72.9166666666667%) which is currently in process

Update comment by auto on 04 Aug 2008 14:08

Domain "2qjyB02" hits Domain "1zrtD02" (64.1025641025641% over 81.25%) which is currently in process

Update comment by auto on 04 Aug 2008 13:54

Domain "2qjyB02" hits Domain "2fynH02" (100% over 100%) which is currently in process

Update comment by auto on 04 Aug 2008 13:45

Domain "2qjyB02" hits Domain "2fynB02" (100% over 100%) which is currently in process

Update comment by auto on 04 Aug 2008 13:35

Domain "2qjyB02" hits Domain "2fynE02" (100% over 100%) which is currently in process

Update comment by auto on 04 Aug 2008 13:22

Domain "2qjyB02" hits Domain "2fynQ02" (100% over 100%) which is currently in process

Update comment by auto on 04 Aug 2008 13:10

Domain "2qjyB02" hits Domain "2fynN02" (100% over 100%) which is currently in process

Update comment by auto on 04 Aug 2008 12:55

Domain "2qjyB02" hits Domain "1zrtQ02" (64.1025641025641% over 81.25%) which is currently in process

Update comment by auto on 23 Jul 2008 18:32

Domain "2qjyB02" hits Domain "2fynK02" (100% over 100%) which is currently in process

Update comment by auto on 29 Dec 2007 17:20

Domain "2qjyB02" hits Domain "2fynK02" (100% over 100%) which is currently in process

Flow stage update by auto on 29 Dec 2007 17:05

Domain "2qjyB02" hits Domain "2fynK02" (100% over 100%) which is currently in process

Flow stage update by auto on 29 Dec 2007 17:05

NW result present for Domain "2qjyB02"

Flow stage update by auto on 29 Dec 2007 08:06

All required files are present for Domain "2qjyB02"

Flow stage update by auto on 28 Dec 2007 11:49

Beginning processing for Domain "2qjyB02"

Insertion by auto on 28 Dec 2007 11:39

Final ChopClose added based on similarity with "2fynB"