CATH Domain: 2qjvA01 XML data for domain: 2qjvA01

Molscript image for 2qjvA01
2qjvA01
PDB coordinates for domain 2qjvA01

PDB 2qjv, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.120 Jelly Rolls
2.60.120.10 Jelly Rolls Gene3D
2.60.120.10.14
2.60.120.10.14.1
2.60.120.10.14.1.1
2.60.120.10.14.1.1.1
2.60.120.10.14.1.1.1.1

[top]
Segment boundaries for domain 2qjvA01

Chopping figure for domain 2qjvA01
DomainStart PDB ResidueStop PDB Residue
2qjvA01 2 12
2qjvA01 126 264
2qjvA02 13 125

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 2.60.120.10.14.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1j1lA01 78.21 PirinTranscription from RNA polymerase II promoterNucleusTranscription cofactor activityHomo sapiens 2.60.120.10 118 10 72 3.48 4.79
2q30A01 75.96 Desulfovibrio desulfuricans subsp. desulfuricans str. G20Putative uncharacterized protein 2.60.120.10 85 17 57 2.72 4.74
1y9qA02 75.45 Vibrio choleraeTranscriptional regulator, HTH_3 family 2.60.120.10 90 12 60 2.77 4.55
1nlqE00 71.05 Nucleoplasmin-like proteinNucleophosmin 3Histone bindingDrosophila melanogasterSUMO binding 2.60.120.340 98 5 55 2.73 4.94
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qjvA01
ANLLSTCTSESGVEHRGGRNQRLVHNILPDSQLADSLLVVEVYTNAGATSSWPAHHDTAVEGQETYLEETYYHRFNPPQG
FCLQRVYTDDRSLDECAVYNRDVVVPGYHPVATIAGYDNYYLNVAGPLRWRFTWEENHAWINS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qjvA01
GXANLLSTCTSESGVEHRGXGRNQRLVHNILPDSQLADSLLVVEVYTNAGATSSWPAHXHDTAVEGQETYLEETYYHRFN
PPQGFCLQRVYTDDRSLDECXAVYNRDVVXVPXGYHPVATIAGYDNYYLNVXAGPLRXWRFTWEENHAWINSPDYPR
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 06 Jan 2009 15:41

Assigning to "2.60.120.10" based on similarity with "2qjvB01"

Flow stage update by auto on 06 Jan 2009 15:24

No in_process hits for Domain "2qjvA01" ready to be processed

Update comment by auto on 14 Sep 2008 17:14

Domain "2qjvA01" hits Domain "2qjvB01" (94.9044585987261% over 100%) which is currently in process

Flow stage update by auto on 14 Sep 2008 17:11

Domain "2qjvA01" hits Domain "2qjvB01" (94.9044585987261% over 100%) which is currently in process

Flow stage update by auto on 14 Sep 2008 17:11

NW result present for Domain "2qjvA01"

Flow stage update by auto on 11 Sep 2008 11:06

All required files are present for Domain "2qjvA01"

Flow stage update by auto on 10 Sep 2008 17:44

Beginning processing for Domain "2qjvA01"

Insertion by auto on 10 Sep 2008 14:06

Final ChopClose added based on similarity with "2qjvB"