CATH Domain: 2qjpB02 XML data for domain: 2qjpB02

Molscript image for 2qjpB02
2qjpB02
PDB coordinates for domain 2qjpB02

PDB 2qjp, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.5 Single alpha-helices involved in coiled-coils or other helix-helix interfaces
1.20.5.100 Gene3D
1.20.5.100.4
1.20.5.100.4.1
1.20.5.100.4.1.1
1.20.5.100.4.1.1.1
1.20.5.100.4.1.1.1.1

[top]
Segment boundaries for domain 2qjpB02

Chopping figure for domain 2qjpB02
DomainStart PDB ResidueStop PDB Residue
2qjpB01 1 221
2qjpB02 222 256

Structural Neighbourhood (129 entries)

There are 129 matching structural neighberhood comparisons for CATH ID 1.20.5.100.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 129 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1piqA00 90.55 NucleusPositive regulation of RNA polymerase II transcriptional preinitiation complex assemblyGeneral control protein GCN4General control protein GCN4Specific RNA polymerase II transcription factor activity 1.20.5.170 31 6 88 1.17 1.32
2p7jB01 88.68 Vibrio parahaemolyticusPutative sensory box/GGDEF family protein 1.20.5.170 39 5 87 2.01 2.31
1tiiC00 87.96 Heat-labile enterotoxin IIB, A chainEscherichia coli 1.20.5.200 36 8 86 1.75 2.03
2hr3A01 87.86 Probable transcriptional regulatorPseudomonas aeruginosa 1.20.5.420 30 10 82 1.02 1.23
2o1kA00 87.54 Simian rotavirus A/SA11-bothNon-structural glycoprotein 4 1.20.5.430 42 5 78 1.23 1.57
2h8pD00 87.31 1.20.5.110 43 14 81 1.54 1.89
2k9jB00 87.16 Positive regulation of endothelial cell migrationPlatelet-derived growth factor receptor bindingPositive regulation of endothelial cell proliferationActivation of protein kinase activityRegulation of bone resorption 1.20.5.100 43 14 81 1.67 2.05
1vf5C03 86.78 Mastigocladus laminosusApocytochrome f 1.20.5.700 32 9 85 1.78 2.08
1owaA01 86.39 Structural constituent of cytoskeletonSpectrinHomo sapiensSpectrin-associated cytoskeletonActin filament organization 1.20.5.170 32 3 82 2.40 2.90
1hj0A00 86.28 Bos taurusThymosin beta-10 1.20.5.520 41 14 85 3.98 4.66
1ybkA00 86.15 TetrabrachionStaphylothermus marinus 1.20.5.1060 52 2 67 1.38 2.05
1nkzB00 86.13 Rhodoblastus acidophilusLight-harvesting protein B-800/850 beta chain 1.20.5.250 41 2 85 2.53 2.96
1jekA00 86.04 Visna/maedi virus EV1 KV1772Envelope glycoprotein gp160 1.20.5.440 40 2 82 2.10 2.55
1a2xB00 85.44 Troponin I, fast skeletal muscleTroponin T bindingOryctolagus cuniculus 1.20.5.420 31 3 74 1.05 1.41
1g2cB00 85.37 Human respiratory syncytial virus strain RSS-2Fusion glycoprotein F0 1.20.5.170 40 8 82 2.25 2.73
2zxeB01 85.18 1.20.5.170 35 11 71 1.04 1.46
1dipB01 84.74 Sus scrofaTSC22 domain family protein 3 1.20.5.490 45 5 75 2.70 3.57
1junA00 84.62 Pathways in cancerChagas diseaseNeurotrophin signaling pathwayB cell receptor signaling pathwayT cell receptor signaling pathway 1.20.5.170 43 11 67 1.38 2.05
1fdoA05 84.54 Methane metabolismMetabolic pathwaysGlyoxylate and dicarboxylate metabolismFormate dehydrogenase HFormate dehydrogenase, alpha subunit [EC:1.2.1.2] 1.20.5.460 27 11 77 1.66 2.15
1hf9A00 84.31 Protein homodimerization activityNegative regulation of hydrolase activityATPase inhibitor activityBos taurusATPase binding 1.20.5.500 41 5 85 2.68 3.14
2k1aA00 84.21 Integrin alpha 2BIdentical protein bindingPathways in cancerHematopoietic cell lineageDilated cardiomyopathy 1.20.5.930 42 8 80 2.54 3.14
2jwaA00 84.04 Heart developmentTransmembrane receptor protein tyrosine kinase signaling pathwayCell proliferationPositive regulation of cell adhesionProtein heterodimerization activity 1.20.5.100 44 14 79 2.96 3.72
1xrdA01 84.00 Light-harvesting complex 1 alpha chainRhodospirillum rubrumLight-harvesting protein B-870 alpha chain 1.20.5.890 43 8 67 1.09 1.62
3fwlA01 83.84 Peptidoglycan biosynthesisPenicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]Penicillin bindingPenicillin-binding protein 1BPeptidoglycan biosynthetic process 1.20.5.100 31 9 77 1.41 1.83
2qjyC01 83.81 Oxidative phosphorylationMetabolic pathwaysRhodobacter sphaeroidesUbiquinol-cytochrome c reductase iron-sulfur subunitUbiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2] 1.20.5.510 33 12 77 2.54 3.29
1m56D00 83.45 Rhodobacter sphaeroidesAa3-type cytochrome c oxidase subunit IV 1.20.5.160 42 11 66 0.96 1.44
1kv4A00 83.43 Moricin-1Bombyx mori 1.20.5.750 42 11 83 3.18 3.82
1kmiZ01 82.96 Bacterial chemotaxisChemotaxis protein cheZProtein bindingChemotaxis protein CheZEscherichia coli K-12 1.20.5.590 30 6 65 1.20 1.83
1r8eA03 82.91 Multidrug-efflux transporter 1 regulatorBacillus subtilis 1.20.5.490 44 11 72 1.96 2.69
2pjuD03 82.90 Positive regulation of gene-specific transcriptionPropionate catabolism operon regulatory proteinNegative regulation of gene-specific transcriptionEscherichia coli K-12Specific transcriptional repressor activity 1.20.5.170 41 8 70 2.18 3.08
2k9yA00 82.84 ApoptosisIntegral to plasma membraneEphrin type-A receptor 2Homo sapiensEph receptor A2 [EC:2.7.10.1] 1.20.5.510 41 17 85 3.69 4.32
2p10B02 82.77 Mesorhizobium lotiMll9387 protein 1.20.5.460 26 11 74 1.84 2.48
1omiA02 82.56 Listeria monocytogenesListeriolysin regulatory protein 1.20.5.460 27 3 60 0.86 1.43
1pfiA00 82.47 Pseudomonas phage Pf1Capsid protein G8P 1.20.5.230 46 8 63 1.24 1.97
1slqF02 82.38 Outer capsid protein VP4Rhesus rotavirus 1.20.5.170 32 12 62 1.04 1.65
2r44A01 82.06 Cytophaga hutchinsonii ATCC 33406MoxR-like ATPase [EC:3.6.3.-]Putative uncharacterized protein 1.20.5.420 26 11 74 1.85 2.49
1ci6B00 81.82 Mammary gland epithelial cell differentiationMammary gland epithelial cell proliferationCytoplasmProtein heterodimerization activitySequence-specific enhancer binding RNA polymerase II transcription factor activity 1.20.5.170 47 20 63 1.56 2.44
1jmmA01 81.74 Major cell-surface adhesin PAcStreptococcus mutans 1.20.5.250 32 12 60 1.20 2.00
2ifoA00 81.62 Xanthomonas phage XfCapsid protein G8P 1.20.5.230 46 2 60 1.26 2.07
1gl2D00 81.57 Syntaxin-8Rattus norvegicusProtein bindingSyntaxin 8SNARE interactions in vesicular transport 1.20.5.110 54 11 64 1.77 2.73
1kqfB03 81.48 Two-component systemMetabolic pathwaysGlyoxylate and dicarboxylate metabolismMethane metabolismFormate dehydrogenase activity 1.20.5.480 44 5 68 1.83 2.68
1ik7A00 81.45 Regulation of proteolysisProtein domain specific bindingHemocyte proliferationPlasma membraneZygotic specification of dorsal/ventral axis 1.20.5.530 52 17 55 0.95 1.70
1u57A00 81.39 Human immunodeficiency virus type 1 lw12.3 isolateGag polyprotein 1.20.5.760 48 14 72 1.73 2.37
1n7sA00 81.39 SNARE interactions in vesicular transportVasopressin-regulated water reabsorptionRattus norvegicusProtein complex bindingVesicle-mediated transport 1.20.5.110 63 5 55 0.77 1.39
1gl2A00 81.30 Rattus norvegicusProtein complex assemblyVesicle-associated membrane protein 8Cellular membrane fusionVesicle-associated membrane protein 8 1.20.5.110 53 8 54 1.00 1.83
2p1jA02 81.25 Thermotoga maritimaPyrimidine metabolismDNA replicationPurine metabolismMetabolic pathways 1.20.5.140 26 23 62 1.48 2.35
1be3K00 81.16 Cardiac muscle contractionCytochrome b-c1 complex subunit 10Oxidative phosphorylationParkinson's diseaseAlzheimer's disease 1.20.5.220 22 13 54 0.68 1.25
2oarE02 81.00 Large conductance mechanosensitive channel, MscL familyLarge-conductance mechanosensitive channelMycobacterium tuberculosis H37Ra 1.20.5.220 22 18 62 1.44 2.29
1gmjD00 80.87 Negative regulation of hydrolase activityProtein homodimerization activityATPase inhibitor activityBos taurusCalmodulin binding 1.20.5.500 56 2 62 2.75 4.40
1jcdB00 80.83 Peptidoglycan bindingMurein lipoproteinMajor outer membrane lipoprotein LppProtein bindingEscherichia coli K-12 1.20.5.190 52 11 67 2.25 3.34
1go9A00 80.79 1.20.5.480 39 5 64 1.50 2.34
1gd2F00 80.76 NuA4 histone acetyltransferase complexFungal AP-1-like factorResponse to hydrogen peroxideResponse to methylglyoxalCellular response to oxidative stress 1.20.5.170 64 14 54 1.10 2.01
1s3jB01 80.74 Bacillus subtilisUncharacterized HTH-type transcriptional regulator yusO 1.20.5.420 30 10 74 3.18 4.28
2zjsE00 80.72 Protein exportBacterial secretion systemThermus thermophilus HB8Preprotein translocase subunit secEPreprotein translocase subunit SecE 1.20.5.1030 46 8 76 2.23 2.93
1urqC00 80.71 SNARE interactions in vesicular transportSleepRattus norvegicusRegulation of synaptogenesisVoltage-gated potassium channel complex 1.20.5.110 68 11 51 0.92 1.79
2p1jB02 80.63 Thermotoga maritimaPyrimidine metabolismDNA replicationPurine metabolismMetabolic pathways 1.20.5.140 26 23 62 1.81 2.88
1e5wA04 80.58 Leukocyte migrationReceptor bindingCytoskeletonMembrane to membrane dockingNucleolus 1.20.5.450 55 2 63 1.87 2.94
2o01J01 80.47 Photosystem I reaction center subunit IXSpinacia oleracea 1.20.5.510 25 16 71 2.39 3.35
3kpeA00 80.34 Fusion glycoprotein F0Human respiratory syncytial virus A2 1.20.5.300 47 0 72 2.89 4.00
1nwqA00 80.20 Protein domain specific bindingRattus norvegicusAcute-phase responsePathways in cancerOrgan regeneration 1.20.5.170 60 8 58 1.69 2.90
1ozhA03 80.14 Acetolactate synthase, catabolicKlebsiella pneumoniae 1.20.5.740 24 8 62 2.49 3.96
1h8bB00 80.03 TitinOryctolagus cuniculus 1.20.5.510 23 13 65 2.30 3.50
1vl2B03 79.93 Thermotoga maritimaArginine and proline metabolismArgininosuccinate synthase [EC:6.3.4.5]Alanine, aspartate and glutamate metabolismArgininosuccinate synthase 1.20.5.470 30 6 85 3.53 4.12
1n7sB00 79.74 Protein domain specific bindingActomyosinMyosin head/neck bindingRattus norvegicusProtein binding, bridging 1.20.5.110 68 5 51 1.14 2.21
3e7kA00 79.72 Rattus norvegicusCalcium channel activityCalcium ion transportIntegral to membraneProtein binding 1.20.5.1010 54 2 61 2.06 3.37
1mqsB00 79.72 Vesicle fusionSyntaxin 5SNAP receptor activityER to Golgi vesicle-mediated transportRetrograde vesicle-mediated transport, Golgi to ER 1.20.5.460 26 15 74 3.58 4.82
1nt2B02 79.71 Archaeoglobus fulgidusProtein bindingPutative uncharacterized protein 1.10.287.660 67 11 52 1.13 2.16
1kilE00 79.54 Complexin-1Syntaxin-1 bindingRattus norvegicusDendriteSynaptobrevin 2-SNAP-25-syntaxin-1a-complexin I complex 1.20.5.580 41 8 65 2.28 3.46
1jocA01 79.53 Zinc ion bindingVesicle fusionMembrane fractionSynaptic vesicle to endosome fusionProtein homodimerization activity 1.20.5.390 60 8 58 1.74 2.98
1a02F00 79.51 Promoter bindingPathways in cancerChagas diseaseProto-oncogene protein c-fosB cell receptor signaling pathway 1.20.5.170 53 14 66 2.55 3.86
3c8vA04 79.17 Desulfovibrio desulfuricans subsp. desulfuricans str. G20Putative uncharacterized protein 1.20.5.510 19 5 54 0.74 1.36
1gl2C00 79.08 Mus musculusVesicle transport through interaction with t-SNAREs homolog 1BGolgi apparatusProtein binding 1.20.5.110 59 0 50 1.44 2.83
1ow6A01 78.98 Focal adhesion kinase 1Focal adhesionCytoskeletonIntegrin-mediated signaling pathwayHomo sapiens 1.20.5.540 30 3 54 2.07 3.81
1svfC00 78.92 Simian virus 5 (strain W3)Fusion glycoprotein F0 1.20.5.300 62 5 54 1.58 2.88
1dh3A00 78.86 Positive regulation of multicellular organism growthLactationRegulation of cell sizeAxonogenesisMus musculus 1.20.5.170 55 11 63 2.96 4.65
1ci6A00 78.07 Positive regulation of transcription from RNA polymerase II promoterCellular amino acid metabolic processNeurotrophin signaling pathwayActivating transcription factor 4Sequence-specific DNA binding transcription factor activity 1.20.5.170 56 5 44 0.71 1.59
2i8dA02 77.84 Hypothetical proteinLactobacillus casei ATCC 334Putative uncharacterized protein 1.20.5.420 30 6 54 2.09 3.85
2dw3A01 77.83 Intrinsic membrane protein pufXRhodobacter sphaeroides 2.4.1 1.20.5.920 55 5 60 2.40 4.00
1rh5B00 77.76 Protein transport protein SEC61 subunit gamma and related proteinsProtein exportMethanocaldococcus jannaschiiPreprotein translocase subunit secE 1.20.5.820 56 2 48 1.05 2.18
1k04A01 77.68 Focal adhesion kinase 1Focal adhesionIntegrin-mediated signaling pathwayCytoskeletonHomo sapiens 1.20.5.540 38 2 50 1.83 3.66
3bz1H01 77.42 PhotosynthesisThermosynechococcus elongatus BP-1Photosystem II PsbH proteinPhotosystem II reaction center protein HMetabolic pathways 1.20.5.880 51 14 56 1.83 3.22
2k37A00 77.30 Bacteriochlorophyll c-binding proteinChlorobaculum tepidumChlorosome envelope protein A 1.20.5.950 59 11 50 1.50 2.95
1gl2B00 77.20 Mus musculusSyntaxin-7 1.20.5.110 59 8 49 1.34 2.73
2qsiA02 77.13 Putative hydrogenase expression/formation protein hupGHydrogenase-1 operon protein HyaERhodopseudomonas palustris 1.20.5.510 27 3 54 2.68 4.94
1czqA00 77.07 1.20.5.170 45 0 44 0.55 1.24
1n7sD00 77.00 SNARE interactions in vesicular transportSleepRattus norvegicusRegulation of synaptogenesisVoltage-gated potassium channel complex 1.20.5.110 66 2 42 0.73 1.72
1csbA01 76.96 Regulation of apoptosisLysosomeHomo sapiensCathepsin B [EC:3.4.22.1]Cathepsin B 1.20.5.170 42 2 52 2.24 4.28
2qiwA02 76.86 Corynebacterium glutamicumPEP phosphonomutase and related enzymes 1.20.5.510 18 16 51 1.16 2.26
1wt6B00 76.72 ATP bindingProtein phosphorylationRegulation of heart contractionHomo sapiensProtein serine/threonine kinase activity 1.20.5.340 67 2 52 2.22 4.25
3ii6A02 76.71 DNA ligation involved in DNA repairProtein C-terminus bindingDNA-dependent protein kinase-DNA ligase 4 complexResponse to X-rayDouble-strand break repair via nonhomologous end joining 1.20.5.370 58 5 46 0.89 1.91
3efgA00 76.41 Xanthomonas campestris pv. campestrisSlyX proteinProtein slyX homolog 1.20.5.300 49 5 61 2.73 4.46
1nhlA00 76.24 Vesicle targetingAzurophil granuleCellular membrane fusionSynaptosomal-associated protein 23Protein binding 1.20.5.110 52 5 48 0.87 1.81
1gk6B00 76.19 Positive regulation of RNA polymerase II transcriptional preinitiation complex assemblyIntermediate filamentVimentinCytosolPositive regulation of gene-specific transcription from RNA polymerase II promoter 1.20.5.170 52 11 50 1.43 2.86
1gu4A00 76.12 Transcription from RNA polymerase II promoterAcute-phase responseHomo sapiensCCAAT/enhancer-binding protein betaImmune response 1.20.5.170 65 8 53 2.46 4.57
2e42A00 76.05 Transcription from RNA polymerase II promoterAcute-phase responseHomo sapiensCCAAT/enhancer-binding protein betaImmune response 1.20.5.170 65 8 53 2.49 4.62
1jthB00 76.01 Protein domain specific bindingMyosin head/neck bindingActomyosinRattus norvegicusProtein heterodimerization activity 1.20.5.110 67 8 43 0.78 1.80
2oarA02 75.89 Large conductance mechanosensitive channel, MscL familyLarge-conductance mechanosensitive channelMycobacterium tuberculosis H37Ra 1.20.5.220 17 5 42 0.46 1.07
1gk4C00 75.84 Cellular component movementProtein C-terminus bindingIntermediate filamentVimentinCytosol 1.20.5.170 70 14 50 1.98 3.96
1m8oB00 75.45 Positive regulation of endothelial cell migrationPlatelet-derived growth factor receptor bindingPositive regulation of endothelial cell proliferationActivation of protein kinase activityRegulation of bone resorption 1.20.5.630 47 5 63 2.93 4.59
3b5nA00 75.08 Synaptobrevin homolog 1Vesicle fusionSNAP receptor activityPlasma membraneVesicle-associated membrane protein 4 1.20.5.110 61 8 49 1.82 3.70
1n2dC00 75.01 Mating projection tipGolgi inheritanceActin filament bindingVesicle-mediated transportMyosin-2 1.20.5.190 48 5 41 0.71 1.70
1onvB00 74.95 CTD phosphatase activityProtein dephosphorylationHomo sapiensRNA polymerase II subunit A C-terminal domain phosphataseDNA-directed RNA polymerase activity 1.20.5.670 21 19 60 2.42 4.03
1pl5A00 74.73 Chromatin silencing complexLoss of chromatin silencing involved in replicative cell agingChromatin silencingDouble-strand break repair via nonhomologous end joiningDouble-stranded DNA binding 1.20.5.730 75 5 45 1.81 3.99
2p2uA01 74.46 Desulfovibrio vulgaris str. HildenboroughHost-nuclease inhibitor protein Gam, putative 1.20.5.170 69 11 50 1.71 3.37
1dp5B00 74.42 CytoplasmProtease A inhibitor 3Saccharomyces cerevisiaeVacuolar protein catabolic processProtein binding 1.20.5.140 31 12 42 0.64 1.49
1no4C00 74.05 Bacillus phage phi29Head morphogenesis protein 1.20.5.400 73 8 47 1.92 4.00
1l2pA00 73.96 Oxidative phosphorylationMetabolic pathwaysATP synthesis coupled proton transportAnchored to membraneF-type H+-transporting ATPase subunit b [EC:3.6.3.14] 1.20.5.620 61 14 37 0.63 1.67
2v4hB00 73.75 Mus musculusNF-kappa-B essential modulatorActivation of NF-kappaB-inducing kinase activityB cell homeostasis 1.20.5.990 91 20 38 0.98 2.55
1y9bA00 73.74 Vibrio choleraePutative uncharacterized protein 1.20.5.780 78 8 43 2.15 4.93
3clqB01 73.70 Enterococcus faecalisPutative uncharacterized protein 1.20.5.220 24 8 42 0.50 1.17
1nknA00 73.56 NucleusPositive regulation of RNA polymerase II transcriptional preinitiation complex assemblyGeneral control protein GCN4General control protein GCN4Positive regulation of gene-specific transcription from RNA polymerase II promoter 1.20.5.340 74 8 47 2.09 4.42
2wscH01 73.44 Photosystem I reaction center subunit VI, chloroplasticSpinacia oleracea 1.20.5.220 23 13 65 2.56 3.90
2wwwC01 73.40 Methylmalonic aciduria type A protein, mitochondrialHomo sapiensLAO/AO transport system kinase [EC:2.7.-.-] 1.20.5.170 52 2 44 1.37 3.10
1d66B02 73.18 Regulatory protein GAL4NucleusSequence-specific DNA binding transcription factor activityTranscription activator activityPositive regulation of transcription by galactose 1.20.5.640 15 13 42 0.47 1.10
1pp9E01 72.55 Cytochrome b-c1 complex subunit Rieske, mitochondrialBos taurus 1.20.5.270 64 5 40 1.58 3.89
3b5nJ00 72.53 Cellular membrane fusionSNARE complexPhosphatidylinositol-3,5-bisphosphate bindingSyntaxin 1B/2/3Prospore membrane 1.20.5.110 64 2 42 1.40 3.32
1t3jA00 72.53 Mus musculusMitochondrial fusionMitofusin-1Protein binding 1.20.5.110 62 8 38 0.98 2.53
1mslA02 72.43 1.20.5.220 18 0 45 1.18 2.58
1wmkA03 72.15 Death-associated protein kinase 2Bladder cancerIdentical protein bindingPathways in cancerATP binding 1.20.5.460 28 7 68 3.25 4.74
1mkmA02 71.52 Thermotoga maritimaTranscriptional regulator, IclR family 1.20.5.640 14 7 40 0.64 1.60
1ik9B02 71.38 DNA ligation involved in DNA repairResponse to X-rayDNA-dependent protein kinase-DNA ligase 4 complexProtein C-terminus bindingDouble-strand break repair via nonhomologous end joining 1.20.5.370 83 8 42 1.55 3.68
1k87A01 71.30 Arginine and proline metabolismMetabolic pathwaysAlanine, aspartate and glutamate metabolism1-pyrroline-5-carboxylate dehydrogenase activityBifunctional protein putA 1.20.5.550 52 11 34 0.40 1.16
1ytzT00 71.01 Troponin T, fast skeletal muscle isoformsGallus gallus 1.20.5.350 90 5 38 1.87 4.81
1sfcH00 70.81 SNARE interactions in vesicular transportSleepRattus norvegicusRegulation of synaptogenesisVoltage-gated potassium channel complex 1.20.5.110 72 2 36 1.15 3.18
1j1dF01 70.32 Protein domain specific bindingCardiac muscle contractionDilated cardiomyopathyActin bindingNegative regulation of ATPase activity 1.20.5.350 102 14 34 1.53 4.46
2zvoB00 70.25 Mus musculusNF-kappa-B essential modulatorActivation of NF-kappaB-inducing kinase activityB cell homeostasis 1.20.5.990 88 11 39 1.93 4.85
1d7mA00 69.67 Cortexillin-1Response to bacteriumProtein homodimerization activityActin filament bundle assemblyActin filament network formation 1.20.5.1050 101 8 34 1.53 4.42
2pp6A01 68.89 Salmonella enterica subsp. enterica serovar TyphimuriumGifsy-2 prophage ATP-binding sugar transporter-like protein 1.20.5.110 21 14 42 1.76 4.11
2basA02 68.19 Bacillus subtilisUncharacterized EAL-domain containing protein ykuI 1.20.5.170 46 5 36 1.45 3.92
[1]
Displaying entries 1 to 129 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qjpB02
KLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qjpB02
KLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK
BLAST against CATH

[top]
Domain History Events (25)

Domain assigned by auto on 04 Aug 2008 15:35

Assigning to "1.20.5.100" based on similarity with "2qjkB02"

Flow stage update by auto on 04 Aug 2008 15:34

No in_process hits for Domain "2qjpB02" ready to be processed

Update comment by auto on 04 Aug 2008 15:32

Domain "2qjpB02" hits Domain "2qjpE02" (100% over 100%) which is currently in process

Update comment by auto on 04 Aug 2008 15:29

Domain "2qjpB02" hits Domain "2qjpK02" (100% over 100%) which is currently in process

Update comment by auto on 04 Aug 2008 15:27

Domain "2qjpB02" hits Domain "2qjpH02" (100% over 100%) which is currently in process

Update comment by auto on 04 Aug 2008 15:17

Domain "2qjpB02" hits Domain "2qjkQ02" (100% over 100%) which is currently in process

Update comment by auto on 04 Aug 2008 15:07

Domain "2qjpB02" hits Domain "2qjkN02" (100% over 100%) which is currently in process

Update comment by auto on 04 Aug 2008 14:56

Domain "2qjpB02" hits Domain "2qjkK02" (100% over 100%) which is currently in process

Update comment by auto on 04 Aug 2008 14:45

Domain "2qjpB02" hits Domain "2qjkH02" (100% over 100%) which is currently in process

Update comment by auto on 04 Aug 2008 14:35

Domain "2qjpB02" hits Domain "2qjkE02" (100% over 100%) which is currently in process

Update comment by auto on 04 Aug 2008 14:22

Domain "2qjpB02" hits Domain "2qjkB02" (100% over 100%) which is currently in process

Update comment by auto on 04 Aug 2008 14:08

Domain "2qjpB02" hits Domain "1zrtD02" (65.7142857142857% over 89.7435897435897%) which is currently in process

Update comment by auto on 04 Aug 2008 13:54

Domain "2qjpB02" hits Domain "2fynH02" (100% over 72.9166666666667%) which is currently in process

Update comment by auto on 04 Aug 2008 13:45

Domain "2qjpB02" hits Domain "2fynB02" (100% over 72.9166666666667%) which is currently in process

Update comment by auto on 04 Aug 2008 13:35

Domain "2qjpB02" hits Domain "2fynE02" (100% over 72.9166666666667%) which is currently in process

Update comment by auto on 04 Aug 2008 13:22

Domain "2qjpB02" hits Domain "2fynQ02" (100% over 72.9166666666667%) which is currently in process

Update comment by auto on 04 Aug 2008 13:10

Domain "2qjpB02" hits Domain "2fynN02" (100% over 72.9166666666667%) which is currently in process

Update comment by auto on 04 Aug 2008 12:55

Domain "2qjpB02" hits Domain "1zrtQ02" (65.7142857142857% over 89.7435897435897%) which is currently in process

Update comment by auto on 23 Jul 2008 18:32

Domain "2qjpB02" hits Domain "2fynK02" (100% over 72.9166666666667%) which is currently in process

Update comment by auto on 29 Dec 2007 17:20

Domain "2qjpB02" hits Domain "2fynK02" (100% over 72.9166666666667%) which is currently in process

Flow stage update by auto on 29 Dec 2007 17:05

Domain "2qjpB02" hits Domain "2fynK02" (100% over 72.9166666666667%) which is currently in process

Flow stage update by auto on 29 Dec 2007 17:05

NW result present for Domain "2qjpB02"

Flow stage update by auto on 29 Dec 2007 08:06

All required files are present for Domain "2qjpB02"

Flow stage update by auto on 28 Dec 2007 11:49

Beginning processing for Domain "2qjpB02"

Insertion by auto on 28 Dec 2007 11:26

Final ChopClose added based on similarity with "2qjkB"