Domain assigned by cuff on 18 Feb 2008 13:39
similar function and structure
CATH Domain: 2qjcA00
2qjcA00
PDB 2qjc, Chain A, Domain 0
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 3.60.21.10.12.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
1g5bB00 | 85.24 | 3.60.21.10 | 221 | 18 | 88 | 3.05 | 3.46 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|2qjcA00 YANVVTLPNVTGRVIIVGDIHGCRAQLEDLLRAVSFKQGSDTLVAVGDLVNKGPDSFGVVRLLKRLGAYSVLGNHDAKLL KLVKKLSLAPLAQSIPTDVETYLSQLPHIIRIPAHNVVAHAGLHPQRPVDRQYEDEVTTRNLIEKVTLTATEETNDGGKP WASWRGPETVVFGHDARRGLQEQYKPLAIGLDSRCVYGGRLSAAVFPGGCIISVPGWNG
Domain COMBS Sequence
>pdb|2qjcA00 XSLKVQGYANVVTLPNVTGRVIIVGDIHGCRAQLEDLLRAVSFKQGSDTLVAVGDLVNKGPDSFGVVRLLKRLGAYSVLG NHDAKLLKLVKKLGKKECLKGRDAKSSLAPLAQSIPTDVETYLSQLPHIIRIPAHNVXVAHAGLHPQRPVDRQYEDEVTT XRNLIEKEQEATGGVTLTATEETNDGGKPWASXWRGPETVVFGHDARRGLQEQYKPLAIGLDSRCVYGGRLSAAVFPGGC IISVPGWNGASAAAEGHHHHHH
Domain History Events (133)
Homcheck review by tronnberg on 10 Dec 2007 15:11
SSAP: 85.2 OV: 88 SEQ: 18. Functionally diffeent.
Flow stage update by tronnberg on 10 Dec 2007 15:11
SSAP: 85.2 OV: 88 SEQ: 18. Functionally diffeent.
Domain assignment manual match h by tronnberg on 10 Dec 2007 15:11
SSAP: 85.2 OV: 88 SEQ: 18. Functionally diffeent.
Homcheck allotment by tronnberg on 10 Dec 2007 15:09
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 10 Dec 2007 15:09
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 09 Dec 2007 15:04
Domain "2qjcA00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 09 Dec 2007 15:04
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qjcA00
Flow stage update by auto on 08 Dec 2007 14:51
Retrieved PRC_PFAMCATH results for job ID SID0045173574304992 and results inserted.
Domain scan prc pfamcath by auto on 08 Dec 2007 14:51
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 23 results for 2qjcA00
Update comment by auto on 08 Dec 2007 03:21
PRC_PFAMCATH job SID0045173574304992 is not yet finished.
Prc pfamcath submit by auto on 08 Dec 2007 03:19
The entry "2qjcA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 08 Dec 2007 03:19
The entry "2qjcA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 08 Dec 2007 03:02
Retrieved SSAP results for job ID SID0472597953474524 and results inserted.
Domain scan ssap cath by auto on 08 Dec 2007 03:02
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 170 results for 2qjcA00
Update comment by auto on 05 Dec 2007 22:51
SSAP job SID0472597953474524 is not yet finished.
Ssap cath submit by auto on 05 Dec 2007 22:38
The entry "2qjcA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Dec 2007 22:38
The entry "2qjcA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Dec 2007 22:36
Retrieved PRC results for job ID SID5203699994578528 and inserted them into the database.
Domain scan prc cath by auto on 05 Dec 2007 22:35
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 14 results for 2qjcA00
Update comment by auto on 05 Dec 2007 18:54
PRC job SID5203699994578528 is not yet finished.
Prc cath submit by auto on 05 Dec 2007 18:42
The entry "2qjcA00" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Dec 2007 18:42
The entry "2qjcA00" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Dec 2007 18:37
Retrieved HMM(SAM) results for job ID SID4317812317895200 and inserted them into the database.
Domain scan sam cath by auto on 05 Dec 2007 18:37
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 9 results for 2qjcA00
Update comment by auto on 05 Dec 2007 14:50
HMM(SAM) job SID4317812317895200 is not yet finished.
Sam cath submit by auto on 05 Dec 2007 14:40
The entry "2qjcA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 05 Dec 2007 14:40
The entry "2qjcA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 05 Dec 2007 14:36
Retrieved "2qjcA00" CATHEDRAL results for job ID SID4023719520711966 and inserted them into the database.
Domain scan cathedral cath by auto on 05 Dec 2007 14:35
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 483 results for 2qjcA00
Update comment by auto on 05 Dec 2007 06:38
"2qjcA00" CATHEDRAL job SID4023719520711966 is not yet finished.
Cathedral cath submit by auto on 05 Dec 2007 06:32
The entry "2qjcA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 05 Dec 2007 06:32
The entry "2qjcA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 05 Dec 2007 03:33
Unable to insert the domain scan results from "2qjcA00" CATHEDRAL job SID8288175984145360.
Update comment by auto on 04 Dec 2007 23:03
"2qjcA00" CATHEDRAL job SID8288175984145360 is not yet finished.
Cathedral cath submit by auto on 04 Dec 2007 22:55
The entry "2qjcA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 04 Dec 2007 22:55
The entry "2qjcA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 04 Dec 2007 22:47
ScanList with 11650 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qjcA00.scanlist" for "2qjcA00"
Write scan list by auto on 04 Dec 2007 22:47
Writing ScanList containing 11650 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qjcA00.scanlist" for domain "2qjcA00"
Update comment by auto on 04 Dec 2007 18:15
Waiting for 43 new domains (example : 2z2eB00) to be processed so that they can be scanned against too.
Update comment by auto on 04 Dec 2007 15:07
Waiting for 127 new domains (example : 2z2eB00) to be processed so that they can be scanned against too.
Update comment by auto on 04 Dec 2007 10:15
Waiting for 206 new domains (example : 2vfzA00) to be processed so that they can be scanned against too.
Update comment by auto on 04 Dec 2007 08:39
Waiting for 257 new domains (example : 2rb8A00) to be processed so that they can be scanned against too.
Update comment by auto on 04 Dec 2007 02:36
Waiting for 335 new domains (example : 2r5qA00) to be processed so that they can be scanned against too.
Update comment by auto on 03 Dec 2007 22:42
Waiting for 410 new domains (example : 2qluA01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Dec 2007 18:16
Waiting for 486 new domains (example : 2o2cB01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Dec 2007 14:51
Waiting for 559 new domains (example : 2ihuB03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Dec 2007 10:16
Waiting for 634 new domains (example : 2e2gJ02) to be processed so that they can be scanned against too.
Update comment by auto on 03 Dec 2007 07:39
Waiting for 665 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 03 Dec 2007 02:42
Waiting for 642 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2007 22:33
Waiting for 633 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2007 18:28
Waiting for 582 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2007 16:55
Waiting for 555 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2007 10:16
Waiting for 492 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2007 07:10
Waiting for 574 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2007 22:15
Waiting for 624 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2007 18:53
Waiting for 698 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2007 14:15
Waiting for 787 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2007 11:43
Waiting for 869 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2007 06:28
Waiting for 942 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2007 02:30
Waiting for 1001 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 30 Nov 2007 23:28
Waiting for 1059 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 30 Nov 2007 18:18
Waiting for 1133 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 30 Nov 2007 14:50
Waiting for 1234 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 30 Nov 2007 10:39
Waiting for 1324 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 30 Nov 2007 08:18
Waiting for 1411 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 29 Nov 2007 22:11
Waiting for 1402 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 29 Nov 2007 11:07
Waiting for 1512 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Flow stage update by auto on 29 Nov 2007 10:33
Moving these domains back to write scan list as we want to avoid any problems caused by the remediation that occurred whilst they were progressing through their scans.
Update comment by auto on 28 Nov 2007 22:37
PRC_PFAMCATH job SID0796357386623104 is not yet finished.
Prc pfamcath submit by auto on 28 Nov 2007 22:32
The entry "2qjcA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 28 Nov 2007 22:32
The entry "2qjcA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 28 Nov 2007 18:50
Unable to retrieve "2qjcA00" PRC_PFAMCATH results for job "SID1217572994472144"
Update comment by auto on 27 Nov 2007 22:33
PRC_PFAMCATH job SID1217572994472144 is not yet finished.
Flow stage update by auto on 27 Nov 2007 22:28
The entry "2qjcA00" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 27 Nov 2007 22:28
The entry "2qjcA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 27 Nov 2007 20:08
Unable to retrieve "2qjcA00" PRC_PFAMCATH results for job "SID1599980698719450"
Update comment by auto on 24 Nov 2007 21:18
PRC_PFAMCATH job SID1599980698719450 is not yet finished.
Prc pfamcath submit by auto on 24 Nov 2007 21:13
The entry "2qjcA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 24 Nov 2007 21:13
The entry "2qjcA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 24 Nov 2007 14:54
Giving up on PRC_PFAMCATH job SID4781061603906800 because submission time of Tue Nov 20 14:24:11 2007 is more than 345600 seconds older than current time (Sat Nov 24 14:54:16 2007).
Update comment by auto on 20 Nov 2007 14:26
PRC_PFAMCATH job SID4781061603906800 is not yet finished.
Prc pfamcath submit by auto on 20 Nov 2007 14:24
The entry "2qjcA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 20 Nov 2007 14:24
The entry "2qjcA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 20 Nov 2007 14:23
Retrieved SSAP results for job ID SID8910115947226840 and results inserted.
Domain scan ssap cath by auto on 20 Nov 2007 14:23
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 164 results for 2qjcA00
Update comment by auto on 17 Nov 2007 18:21
SSAP job SID8910115947226840 is not yet finished.
Ssap cath submit by auto on 17 Nov 2007 18:16
The entry "2qjcA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 17 Nov 2007 18:16
The entry "2qjcA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 17 Nov 2007 14:19
Giving up on SSAP job SID3192709743437856 because submission time of Tue Nov 13 12:02:49 2007 is more than 345600 seconds older than current time (Sat Nov 17 14:19:48 2007).
Update comment by auto on 13 Nov 2007 12:06
SSAP job SID3192709743437856 is not yet finished.
Ssap cath submit by auto on 13 Nov 2007 12:02
The entry "2qjcA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 13 Nov 2007 12:02
The entry "2qjcA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 13 Nov 2007 00:53
Unable to retrieve "2qjcA00" SSAP results for job "SID6236850096157888"
Update comment by auto on 15 Sep 2007 14:31
SSAP job SID6236850096157888 is not yet finished.
Flow stage update by auto on 15 Sep 2007 14:23
The entry "2qjcA00" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 15 Sep 2007 14:23
The entry "2qjcA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 15 Sep 2007 08:32
Giving up on SSAP job SID3535822931962344 because submission time of Sun Sep 9 22:58:01 2007 is more than 345600 seconds older than current time (Sat Sep 15 08:32:01 2007).
Update comment by auto on 09 Sep 2007 23:35
SSAP job SID3535822931962344 is not yet finished.
Ssap cath submit by auto on 09 Sep 2007 22:58
The entry "2qjcA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 22:58
The entry "2qjcA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 20:28
Giving up on SSAP job SID2895132798018576 because submission time of Wed Sep 5 19:08:12 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:28:54 2007).
Update comment by auto on 05 Sep 2007 20:11
SSAP job SID2895132798018576 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 19:08
The entry "2qjcA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 19:08
The entry "2qjcA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 15:27
Retrieved PRC results for job ID SID3439392082590528 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 15:26
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 14 results for 2qjcA00
Flow stage update by auto on 05 Sep 2007 04:46
The entry "2qjcA00" has been submitted to the PRC webservice.
Prc cath submit by auto on 05 Sep 2007 04:46
The entry "2qjcA00" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 03:01
Retrieved HMM(SAM) results for job ID SID6155036537602432 and inserted them into the database.
Domain scan sam cath by auto on 05 Sep 2007 03:00
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 9 results for 2qjcA00
Update comment by auto on 04 Sep 2007 13:36
HMM(SAM) job SID6155036537602432 is not yet finished.
Sam cath submit by auto on 04 Sep 2007 10:44
The entry "2qjcA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 10:44
The entry "2qjcA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 09:17
Retrieved "2qjcA00" CATHEDRAL results for job ID SID5835902949664576 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 09:16
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 482 results for 2qjcA00
Cathedral cath submit by auto on 03 Sep 2007 14:44
The entry "2qjcA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 14:44
The entry "2qjcA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 13:03
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qjcA00.scanlist" for "2qjcA00"
Write scan list by auto on 03 Sep 2007 13:03
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qjcA00.scanlist" for domain "2qjcA00"
Update comment by auto on 03 Sep 2007 10:11
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:33
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:38
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:33
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:23
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:23
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:17
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Flow stage update by auto on 02 Sep 2007 10:12
No satisfactory AssignClose result found.
Flow stage update by auto on 02 Sep 2007 10:04
No in_process hits for Domain "2qjcA00" ready to be processed
Flow stage update by auto on 02 Sep 2007 10:04
NW result present for Domain "2qjcA00"
Flow stage update by auto on 29 Aug 2007 14:34
All required files are present for Domain "2qjcA00"
Flow stage update by auto on 28 Aug 2007 18:20
Beginning processing for Domain "2qjcA00"
Insertion by cuff on 28 Aug 2007 16:32
nice chopping
