CATH Domain: 2qhpA00 XML data for domain: 2qhpA00

Molscript image for 2qhpA00
2qhpA00
PDB coordinates for domain 2qhpA00

PDB 2qhp, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1190 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase
3.40.1190.20 Gene3D
3.40.1190.20.4
3.40.1190.20.4.1
3.40.1190.20.4.1.1
3.40.1190.20.4.1.1.1
3.40.1190.20.4.1.1.1.1

[top]
Segment boundaries for domain 2qhpA00

Chopping figure for domain 2qhpA00
DomainStart PDB ResidueStop PDB Residue
2qhpA00 2 295

Structural Neighbourhood (15 entries)

There are 15 matching structural neighberhood comparisons for CATH ID 3.40.1190.20.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 15 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1tyyB00 84.14 Amino sugar and nucleotide sugar metabolismStarch and sucrose metabolismFructose and mannose metabolismMetabolic pathwaysFructokinase [EC:2.7.1.4] 3.40.1190.20 292 22 90 3.12 3.44
2qcvA01 83.75 5-dehydro-2-deoxygluconokinase [EC:2.7.1.92]Bacillus haloduransInositol phosphate metabolismMetabolic pathways5-dehydro-2-deoxygluconokinase 3.40.1190.20 262 16 88 3.18 3.58
1v1aA00 83.60 Thermus thermophilus HB82-dehydro-3-deoxygluconokinase [EC:2.7.1.45]Pentose and glucuronate interconversionsPentose phosphate pathway2-keto-3-deoxy-gluconate kinase 3.40.1190.20 301 22 88 2.90 3.29
2fv7A00 83.51 Pentose phosphate pathwayRibokinaseRibokinase [EC:2.7.1.15]Homo sapiens 3.40.1190.20 308 18 86 3.19 3.68
2rbcA00 82.36 Sugar kinaseAgrobacterium tumefaciens str. C58 3.40.1190.20 297 16 86 3.35 3.86
1rkdA00 82.30 Pentose phosphate pathwayD-ribose catabolic processRibokinase activityRibokinaseRibokinase [EC:2.7.1.15] 3.40.1190.20 306 16 87 3.33 3.82
2afbB00 82.16 Thermotoga maritima2-dehydro-3-deoxygluconokinase [EC:2.7.1.45]Pentose phosphate pathwayPentose and glucuronate interconversions2-keto-3-deoxygluconate kinase 3.40.1190.20 319 21 85 3.12 3.65
1vk4A00 81.34 Thermotoga maritimaPutative uncharacterized protein 3.40.1190.20 276 16 91 3.02 3.31
2abqA00 81.14 Fructose 1-phosphate kinase1-phosphofructokinase [EC:2.7.1.56]Fructose and mannose metabolismBacillus halodurans 3.40.1190.20 302 14 86 3.83 4.43
1vi9A00 79.84 Vitamin B6 metabolismMetabolic pathwaysPyridoxine kinase [EC:2.7.1.35]CytoplasmPyridoxal 5'-phosphate salvage 3.40.1190.20 279 11 83 3.60 4.33
2nwhA00 79.64 Agrobacterium tumefaciens str. C58Carbohydrate kinase 3.40.1190.20 303 14 86 3.96 4.60
2ajrA01 78.36 Thermotoga maritima1-phosphofructokinase [EC:2.7.1.56]Fructose and mannose metabolismSugar kinase, pfkB family 3.40.1190.20 259 11 88 4.21 4.78
2yxtA00 77.84 Zinc ion bindingPyridoxal kinase activityPotassium ion bindingMetabolic pathwaysCell proliferation 3.40.1190.20 304 10 76 3.61 4.71
3bf5A01 77.73 Pentose phosphate pathwayRibokinase [EC:2.7.1.15]Thermoplasma acidophilumRibokinase related protein 3.40.1190.20 221 21 76 3.29 4.31
2r3bA01 75.17 YjeF-related proteinEnterococcus faecalis 3.40.1190.20 266 10 77 3.80 4.88
[1]
Displaying entries 1 to 15 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qhpA00
NNIIVGGEALWDVLPEGKKIGGAPANFAYHVSQFGFDSRVVSAVGNDELGDEIEVFKEKQLKNQIERVDYPTGTVQVTPC
YEIKEGVAWDNIPFTDELKRLALNTRAVCFGSLAQRNEVSRATINRFLDTPDIDGQLKIFDINLRQDFYTKEVLRESFKR
CNILKINDEELVTISRFGYPGIDLQDKCWILLAKYNLKLILTCGINGSYVFTPGVVSFQETPKVPVADTVGAGDSFTAAF
CASILNGKSVPEAHKLAVEVSAYVCTQSGAPELPVILKDRLL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qhpA00
GXNNIIVGXGEALWDVLPEGKKIGGAPANFAYHVSQFGFDSRVVSAVGNDELGDEIXEVFKEKQLKNQIERVDYPTGTVQ
VTLDDEGVPCYEIKEGVAWDNIPFTDELKRLALNTRAVCFGSLAQRNEVSRATINRFLDTXPDIDGQLKIFDINLRQDFY
TKEVLRESFKRCNILKINDEELVTISRXFGYPGIDLQDKCWILLAKYNLKXLILTCGINGSYVFTPGVVSFQETPKVPVA
DTVGAGDSFTAAFCASILNGKSVPEAHKLAVEVSAYVCTQSGAXPELPVILKDRLL
BLAST against CATH

[top]
Domain History Events (130)

Domain assigned by cuff on 18 Feb 2008 13:51

same superfamily

Domain assignment manual match h by tronnberg on 10 Dec 2007 14:46

SSAP: 84.1 OV: 90 SEQ: 22. Both are sugar kinases.

Homcheck review by tronnberg on 10 Dec 2007 14:46

SSAP: 84.1 OV: 90 SEQ: 22. Both are sugar kinases.

Flow stage update by tronnberg on 10 Dec 2007 14:46

SSAP: 84.1 OV: 90 SEQ: 22. Both are sugar kinases.

Homcheck allotment by tronnberg on 10 Dec 2007 14:44

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 10 Dec 2007 14:44

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 09 Dec 2007 15:03

Domain "2qhpA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 09 Dec 2007 15:03

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qhpA00

Flow stage update by auto on 08 Dec 2007 18:52

Retrieved PRC_PFAMCATH results for job ID SID5772239021859264 and results inserted.

Domain scan prc pfamcath by auto on 08 Dec 2007 18:52

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 70 results for 2qhpA00

Update comment by auto on 08 Dec 2007 10:35

PRC_PFAMCATH job SID5772239021859264 is not yet finished.

Prc pfamcath submit by auto on 08 Dec 2007 10:33

The entry "2qhpA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Dec 2007 10:33

The entry "2qhpA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Dec 2007 10:16

Retrieved SSAP results for job ID SID1607363416531424 and results inserted.

Domain scan ssap cath by auto on 08 Dec 2007 10:15

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 529 results for 2qhpA00

Update comment by auto on 05 Dec 2007 22:50

SSAP job SID1607363416531424 is not yet finished.

Ssap cath submit by auto on 05 Dec 2007 22:38

The entry "2qhpA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Dec 2007 22:38

The entry "2qhpA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Dec 2007 22:35

Retrieved PRC results for job ID SID0697617754704532 and inserted them into the database.

Domain scan prc cath by auto on 05 Dec 2007 22:35

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 19 results for 2qhpA00

Update comment by auto on 05 Dec 2007 18:52

PRC job SID0697617754704532 is not yet finished.

Prc cath submit by auto on 05 Dec 2007 18:42

The entry "2qhpA00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Dec 2007 18:42

The entry "2qhpA00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Dec 2007 18:36

Retrieved HMM(SAM) results for job ID SID7688929747304608 and inserted them into the database.

Domain scan sam cath by auto on 05 Dec 2007 18:36

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 18 results for 2qhpA00

Update comment by auto on 05 Dec 2007 14:49

HMM(SAM) job SID7688929747304608 is not yet finished.

Sam cath submit by auto on 05 Dec 2007 14:40

The entry "2qhpA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 05 Dec 2007 14:40

The entry "2qhpA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 05 Dec 2007 14:35

Retrieved "2qhpA00" CATHEDRAL results for job ID SID5080350385927088 and inserted them into the database.

Domain scan cathedral cath by auto on 05 Dec 2007 14:34

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 475 results for 2qhpA00

Update comment by auto on 05 Dec 2007 06:38

"2qhpA00" CATHEDRAL job SID5080350385927088 is not yet finished.

Cathedral cath submit by auto on 05 Dec 2007 06:31

The entry "2qhpA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 05 Dec 2007 06:31

The entry "2qhpA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 05 Dec 2007 03:30

Unable to insert the domain scan results from "2qhpA00" CATHEDRAL job SID1381880439071736.

Update comment by auto on 04 Dec 2007 23:02

"2qhpA00" CATHEDRAL job SID1381880439071736 is not yet finished.

Cathedral cath submit by auto on 04 Dec 2007 22:54

The entry "2qhpA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 04 Dec 2007 22:54

The entry "2qhpA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 04 Dec 2007 22:46

ScanList with 11650 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qhpA00.scanlist" for "2qhpA00"

Write scan list by auto on 04 Dec 2007 22:46

Writing ScanList containing 11650 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qhpA00.scanlist" for domain "2qhpA00"

Update comment by auto on 04 Dec 2007 18:15

Waiting for 43 new domains (example : 2z2eB00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 15:07

Waiting for 127 new domains (example : 2z2eB00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 10:15

Waiting for 206 new domains (example : 2vfzA00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 08:39

Waiting for 257 new domains (example : 2rb8A00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 02:36

Waiting for 335 new domains (example : 2r5qA00) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 22:42

Waiting for 410 new domains (example : 2qluA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 18:16

Waiting for 486 new domains (example : 2o2cB01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 14:51

Waiting for 559 new domains (example : 2ihuB03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 10:16

Waiting for 634 new domains (example : 2e2gJ02) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 07:39

Waiting for 665 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 02:42

Waiting for 642 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 22:33

Waiting for 633 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 18:28

Waiting for 582 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 16:55

Waiting for 555 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 10:16

Waiting for 492 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 07:10

Waiting for 574 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 22:15

Waiting for 624 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 18:53

Waiting for 698 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 14:15

Waiting for 787 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 11:43

Waiting for 869 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 06:28

Waiting for 942 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 02:30

Waiting for 1001 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 23:27

Waiting for 1059 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 18:18

Waiting for 1133 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 14:50

Waiting for 1234 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 10:39

Waiting for 1324 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 08:18

Waiting for 1411 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Nov 2007 22:11

Waiting for 1402 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Nov 2007 11:06

Waiting for 1512 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 29 Nov 2007 10:33

Moving these domains back to write scan list as we want to avoid any problems caused by the remediation that occurred whilst they were progressing through their scans.

Update comment by auto on 28 Nov 2007 11:10

PRC_PFAMCATH job SID6453701203481385 is not yet finished.

Flow stage update by auto on 28 Nov 2007 11:06

The entry "2qhpA00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 28 Nov 2007 11:06

The entry "2qhpA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 28 Nov 2007 06:32

Unable to retrieve "2qhpA00" PRC_PFAMCATH results for job "SID3600007244472928"

Update comment by auto on 25 Nov 2007 13:33

PRC_PFAMCATH job SID3600007244472928 is not yet finished.

Flow stage update by auto on 25 Nov 2007 13:29

The entry "2qhpA00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 25 Nov 2007 13:28

The entry "2qhpA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 25 Nov 2007 06:57

Giving up on PRC_PFAMCATH job SID4517761724219280 because submission time of Wed Nov 21 06:19:44 2007 is more than 345600 seconds older than current time (Sun Nov 25 06:57:51 2007).

Update comment by auto on 21 Nov 2007 06:22

PRC_PFAMCATH job SID4517761724219280 is not yet finished.

Flow stage update by auto on 21 Nov 2007 06:19

The entry "2qhpA00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 21 Nov 2007 06:19

The entry "2qhpA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 21 Nov 2007 06:19

Retrieved SSAP results for job ID SID5817184353678848 and results inserted.

Domain scan ssap cath by auto on 21 Nov 2007 06:18

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 502 results for 2qhpA00

Update comment by auto on 17 Nov 2007 18:20

SSAP job SID5817184353678848 is not yet finished.

Flow stage update by auto on 17 Nov 2007 18:15

The entry "2qhpA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 17 Nov 2007 18:15

The entry "2qhpA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 17 Nov 2007 14:19

Giving up on SSAP job SID0482349921142016 because submission time of Tue Nov 13 12:02:07 2007 is more than 345600 seconds older than current time (Sat Nov 17 14:19:01 2007).

Update comment by auto on 13 Nov 2007 12:06

SSAP job SID0482349921142016 is not yet finished.

Ssap cath submit by auto on 13 Nov 2007 12:02

The entry "2qhpA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 13 Nov 2007 12:02

The entry "2qhpA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 13 Nov 2007 00:52

Unable to retrieve "2qhpA00" SSAP results for job "SID1341873394512512"

Update comment by auto on 15 Sep 2007 14:31

SSAP job SID1341873394512512 is not yet finished.

Ssap cath submit by auto on 15 Sep 2007 14:23

The entry "2qhpA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 14:23

The entry "2qhpA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 08:31

Giving up on SSAP job SID9352692785121280 because submission time of Sun Sep 9 22:57:12 2007 is more than 345600 seconds older than current time (Sat Sep 15 08:31:21 2007).

Update comment by auto on 09 Sep 2007 23:34

SSAP job SID9352692785121280 is not yet finished.

Flow stage update by auto on 09 Sep 2007 22:57

The entry "2qhpA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 09 Sep 2007 22:57

The entry "2qhpA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:28

Giving up on SSAP job SID6444822113445802 because submission time of Wed Sep 5 19:07:20 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:28:07 2007).

Update comment by auto on 05 Sep 2007 20:10

SSAP job SID6444822113445802 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 19:07

The entry "2qhpA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 19:07

The entry "2qhpA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 15:19

Retrieved PRC results for job ID SID7048766878857664 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 15:18

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 19 results for 2qhpA00

Prc cath submit by auto on 05 Sep 2007 04:45

The entry "2qhpA00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 04:45

The entry "2qhpA00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 02:55

Retrieved HMM(SAM) results for job ID SID1235435796078729 and inserted them into the database.

Domain scan sam cath by auto on 05 Sep 2007 02:54

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 17 results for 2qhpA00

Update comment by auto on 04 Sep 2007 13:35

HMM(SAM) job SID1235435796078729 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:43

The entry "2qhpA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:43

The entry "2qhpA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 09:09

Retrieved "2qhpA00" CATHEDRAL results for job ID SID8594201579304960 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 09:08

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 474 results for 2qhpA00

Cathedral cath submit by auto on 03 Sep 2007 14:43

The entry "2qhpA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:43

The entry "2qhpA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 13:02

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qhpA00.scanlist" for "2qhpA00"

Write scan list by auto on 03 Sep 2007 13:02

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qhpA00.scanlist" for domain "2qhpA00"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:33

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:38

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:33

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:23

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:23

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:17

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:30

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 02 Sep 2007 02:25

No satisfactory AssignClose result found.

Flow stage update by auto on 02 Sep 2007 02:10

No in_process hits for Domain "2qhpA00" ready to be processed

Flow stage update by auto on 02 Sep 2007 02:10

NW result present for Domain "2qhpA00"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2qhpA00"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2qhpA00"

Insertion by cuff on 23 Aug 2007 14:44

nice chopping