CATH Domain: 2qh5B00 XML data for domain: 2qh5B00

Molscript image for 2qh5B00
2qh5B00
PDB coordinates for domain 2qh5B00

PDB 2qh5, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.550 Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A
3.90.550.10 Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Gene3D
3.90.550.10.16
3.90.550.10.16.1
3.90.550.10.16.1.1
3.90.550.10.16.1.1.1
3.90.550.10.16.1.1.1.1

[top]
Segment boundaries for domain 2qh5B00

Chopping figure for domain 2qh5B00
DomainStart PDB ResidueStop PDB Residue
2qh5B00 1 266

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2qh5B00
LKIKNILLSSRSLYPKQFLKLFDHKSLFELSFKRNASLVDETLIVCNEKHYFLALEEIKNEIKNKSVGFLLESLSKNTAN
AIALSALMSDKEDLLIVTPSDHLIKDLQAYENAIKKAIDLAQKGFLVTFGVSIDKPNTEFGYIESPNGLDVKRFIEKPSL
DKAIEFQKSGGFYFNSGMFVFQAGVFLDELKKHAPTILKGCERAFESLENAYFFEKKIARLSEKSMQDLEDMSIDIALMQ
QSHKIKMVELNAKWSD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qh5B00
MSLKIKNILLSGGSGKRLWPLSRSLYPKQFLKLFDHKSLFELSFKRNASLVDETLIVCNEKHYFLALEEIKNEIKNKSVG
FLLESLSKNTANAIALSALMSDKEDLLIVTPSDHLIKDLQAYENAIKKAIDLAQKGFLVTFGVSIDKPNTEFGYIESPNG
LDVKRFIEKPSLDKAIEFQKSGGFYFNSGMFVFQAGVFLDELKKHAPTILKGCERAFESLENAYFFEKKIARLSEKSMQD
LEDMSIDIALMQQSHKIKMVELNAKWSD
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 07 Mar 2008 17:27

Assigning to "3.90.550.10" based on similarity with "2qh5A00"

Flow stage update by auto on 07 Mar 2008 17:26

No in_process hits for Domain "2qh5B00" ready to be processed

Update comment by auto on 03 Sep 2007 20:10

Domain "2qh5B00" hits Domain "2qh5A00" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2qh5B00" hits Domain "2qh5A00" (100% over 100%) which is currently in process

Update comment by auto on 02 Sep 2007 02:11

Domain "2qh5B00" hits Domain "2qh5A00" (100% over 100%) which is currently in process

Flow stage update by auto on 02 Sep 2007 02:10

Domain "2qh5B00" hits Domain "2qh5A00" (100% over 100%) which is currently in process

Flow stage update by auto on 02 Sep 2007 02:10

NW result present for Domain "2qh5B00"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2qh5B00"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2qh5B00"

Insertion by auto on 23 Aug 2007 15:00

Final ChopClose added based on similarity with "2qh5A"