CATH Domain: 2qgyB01 XML data for domain: 2qgyB01

Molscript image for 2qgyB01
2qgyB01
PDB coordinates for domain 2qgyB01

PDB 2qgy, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.10 Enolase-like, N-terminal domain Gene3D
3.30.390.10.13
3.30.390.10.13.1
3.30.390.10.13.1.1
3.30.390.10.13.1.1.1
3.30.390.10.13.1.1.1.1

Segment boundaries for domain 2qgyB01

Chopping figure for domain 2qgyB01
DomainStart PDB ResidueStop PDB Residue
2qgyB01 4 119
2qgyB01 358 378
2qgyB02 120 357

Structural Neighbourhood (15 entries)

There are 15 matching structural neighberhood comparisons for CATH ID 3.30.390.10.13.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 15 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ovlA01 84.71 Toluene and xylene degradationStreptomyces coelicolorMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylationPutative racemase 3.30.390.10 123 22 84 2.49 2.95
3go2A01 84.70 Burkholderia xenovorans LB400Putative uncharacterized protein 3.30.390.10 114 23 82 2.29 2.76
3bjsA01 83.99 Polaromonas sp. JS666Mandelate racemase/muconate lactonizing enzyme 3.30.390.10 116 21 80 3.34 4.17
1ec7C01 83.73 Ascorbate and aldarate metabolismD-glucarate catabolic processGlucarate dehydratase activityGlucarate dehydrataseGlucarate dehydratase [EC:4.2.1.40] 3.30.390.10 136 13 88 3.50 3.97
2qq6B01 83.25 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like protein 3.30.390.10 115 20 82 2.50 3.04
1nu5A01 82.68 Chloromuconate cycloisomerasePseudomonas sp. P51 3.30.390.10 116 18 74 2.16 2.92
2oqyA01 82.30 Muconate cycloisomeraseOceanobacillus iheyensis 3.30.390.10 142 17 84 2.79 3.30
2pgwA01 81.44 Sinorhizobium melilotiToluene and xylene degradationBenzoate degradation via hydroxylationMuconate cycloisomerase [EC:5.5.1.1]Mandelate racemase/muconate lactonizing enzyme family protein 3.30.390.10 147 21 85 3.37 3.96
2hzgB01 81.33 Rhodobacter sphaeroides 2.4.1Mandelate racemase/muconate lactonizing enzyme/Enolase superfamily 3.30.390.10 143 14 82 3.65 4.42
1tkkA01 81.14 Bacillus subtilisL-Ala-D/L-Glu epimerase 3.30.390.10 115 21 74 2.50 3.38
2nqlA01 81.13 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.30.390.10 162 18 74 2.38 3.19
1tzzB01 80.93 Bradyrhizobium japonicumBll6730 protein 3.30.390.10 119 11 74 2.67 3.57
1jpdX01 80.02 Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12 3.30.390.10 99 14 71 3.04 4.28
1rvkA01 79.47 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.30.390.10 115 11 74 3.68 4.97
2zadA01 79.07 Thermotoga maritimaL-Ala-D/L-Glu epimerase 3.30.390.10 109 14 72 3.14 4.33
Displaying entries 1 to 15 (page 1 of 1)


Domain ATOM Sequence

>pdb|2qgyB01
QDISIGKLSRLKIWITDNHLSDDQWSNTKKFIIIKITTEDGIEGWGEAFSINFREKGIAIIIKELFREISNIPNLSIKSF
YNKISLLSDGHRGLDFSSATSAIEIALWDISGKLKNLGIVIHEDILSELSIYSLDEK    

Domain COMBS Sequence

>pdb|2qgyB01
MSLNNQDISIGKLSRLKIWITDNHLSDDQWSNTKKFIIIKITTEDGIEGWGEAFSINFREKGIAIIIKELFREISNIPNL
SIKSFYNKISLLSDGHRGLDFSSATSAIEIALWDISGKLKNLGIVIHEDILSELSIYSLDEKSNDEGHHHHHH    

Domain History Events (10)

Domain assigned by auto on 18 Feb 2008 14:12

Assigning to "3.30.390.10" based on similarity with "2qgyA01"

Flow stage update by auto on 18 Feb 2008 13:59

No in_process hits for Domain "2qgyB01" ready to be processed

Update comment by auto on 03 Sep 2007 20:10

Domain "2qgyB01" hits Domain "2qgyA01" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2qgyB01" hits Domain "2qgyA01" (100% over 100%) which is currently in process

Update comment by auto on 02 Sep 2007 02:11

Domain "2qgyB01" hits Domain "2qgyA01" (100% over 100%) which is currently in process

Flow stage update by auto on 02 Sep 2007 02:10

Domain "2qgyB01" hits Domain "2qgyA01" (100% over 100%) which is currently in process

Flow stage update by auto on 02 Sep 2007 02:10

NW result present for Domain "2qgyB01"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2qgyB01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2qgyB01"

Insertion by auto on 23 Aug 2007 15:00

Final ChopClose added based on similarity with "2qgyA"