CATH Domain: 2qgyA02 XML data for domain: 2qgyA02

Molscript image for 2qgyA02
2qgyA02
PDB coordinates for domain 2qgyA02

PDB 2qgy, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.20 Alpha-Beta Barrel
3.20.20 TIM Barrel
3.20.20.120 Enolase superfamily Gene3D
3.20.20.120.8
3.20.20.120.8.1
3.20.20.120.8.1.1
3.20.20.120.8.1.1.1
3.20.20.120.8.1.1.1.1

[top]
Segment boundaries for domain 2qgyA02

Chopping figure for domain 2qgyA02
DomainStart PDB ResidueStop PDB Residue
2qgyA01 3 119
2qgyA01 358 378
2qgyA02 120 357

Structural Neighbourhood (30 entries)

There are 30 matching structural neighberhood comparisons for CATH ID 3.20.20.120.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 30 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3cb3A02 87.30 Toluene and xylene degradationPolaromonas sp. JS666Mandelate racemase [EC:5.1.2.2]Mandelate racemase/muconate lactonizing enzymeBenzoate degradation via hydroxylation 3.20.20.120 233 24 94 2.26 2.38
2pozH02 87.18 Putative dehydrataseMesorhizobium loti 3.20.20.120 246 25 91 2.20 2.39
2ovlA02 87.08 Toluene and xylene degradationStreptomyces coelicolorMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylationPutative racemase 3.20.20.120 223 20 92 1.93 2.09
1mdlA02 86.74 Mandelate racemasePseudomonas putida 3.20.20.120 230 20 94 1.87 1.98
2qq6A02 85.80 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like protein 3.20.20.120 262 25 85 2.02 2.36
2oz8A02 85.54 Mesorhizobium lotiMll7089 protein 3.20.20.120 230 20 93 2.16 2.32
2nqlA02 85.53 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.20.20.120 214 15 90 2.25 2.49
2podB02 85.36 Mandelate racemase / muconate lactonizing enzymeBurkholderia pseudomallei 3.20.20.120 251 20 89 2.26 2.52
1yeyB02 85.04 Xanthomonas campestris pv. campestrisRTS beta protein 3.20.20.120 243 17 86 2.44 2.82
2pgwA02 84.56 Sinorhizobium melilotiToluene and xylene degradationBenzoate degradation via hydroxylationMuconate cycloisomerase [EC:5.5.1.1]Mandelate racemase/muconate lactonizing enzyme family protein 3.20.20.120 215 13 90 2.33 2.56
3bjsA02 84.48 Polaromonas sp. JS666Mandelate racemase/muconate lactonizing enzyme 3.20.20.120 250 19 91 2.48 2.72
3cyjA02 84.47 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like proteinToluene and xylene degradationMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylation 3.20.20.120 235 20 93 2.48 2.66
3go2A02 84.43 Burkholderia xenovorans LB400Putative uncharacterized protein 3.20.20.120 268 19 83 2.26 2.72
2oqyA02 84.30 Muconate cycloisomeraseOceanobacillus iheyensis 3.20.20.120 226 14 92 2.67 2.88
1tzzA02 84.21 Bradyrhizobium japonicumBll6730 protein 3.20.20.120 256 17 86 2.58 2.99
2hzgA02 84.18 Rhodobacter sphaeroides 2.4.1Mandelate racemase/muconate lactonizing enzyme/Enolase superfamily 3.20.20.120 248 16 91 2.56 2.80
2qdeA02 83.92 Aromatoleum aromaticum EbN1Mandelate racemase/muconate lactonizing enzyme family protein 3.20.20.120 239 15 93 2.85 3.05
1tkkA02 83.91 Bacillus subtilisL-Ala-D/L-Glu epimerase 3.20.20.120 244 13 92 2.46 2.67
2oqhA02 83.75 Putative isomeraseStreptomyces coelicolor 3.20.20.120 240 14 91 2.55 2.78
2chrA02 83.27 Ralstonia eutropha JMP134Chloromuconate cycloisomeraseToluene and xylene degradationMuconate cycloisomerase [EC:5.5.1.1]Benzoate degradation via hydroxylation 3.20.20.120 202 19 83 2.13 2.54
2pmqA02 83.19 Roseovarius sp. HTCC2601Mandelate racemase/muconate lactonizing enzyme 3.20.20.120 224 16 93 2.65 2.82
2qvhA02 83.12 Ubiquinone and other terpenoid-quinone biosynthesisThermobifida fusca YXO-succinylbenzoate-CoA synthaseO-succinylbenzoate synthase [EC:4.2.1.113]Metabolic pathways 3.20.20.120 224 14 92 3.18 3.45
3fv9A02 83.02 Mandelate racemase/muconate lactonizing enzyme, putativeRoseovarius nubinhibens ISM 3.20.20.120 243 13 92 2.69 2.91
2qddA02 82.92 Mandelate racemase/muconate lactonizing enzyme, putativeRoseovarius nubinhibens ISM 3.20.20.120 236 16 94 2.75 2.92
1ec7A02 81.75 Ascorbate and aldarate metabolismD-glucarate catabolic processGlucarate dehydratase activityGlucarate dehydrataseGlucarate dehydratase [EC:4.2.1.40] 3.20.20.120 261 12 84 2.48 2.93
1jpdX02 80.12 Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12 3.20.20.120 207 13 88 3.04 3.43
2oztA02 79.66 Ubiquinone and other terpenoid-quinone biosynthesisThermosynechococcus elongatus BP-1O-succinylbenzoate synthase [EC:4.2.1.113]Tlr1174 proteinMetabolic pathways 3.20.20.120 201 12 82 3.03 3.66
3cawA02 77.41 Ubiquinone and other terpenoid-quinone biosynthesisO-succinylbenzoate synthase [EC:4.2.1.113]Bdellovibrio bacteriovorusMetabolic pathwaysPutative uncharacterized protein 3.20.20.120 225 8 89 3.57 4.00
1r6wA01 76.79 Ubiquinone and other terpenoid-quinone biosynthesisMetabolic pathwaysMenaquinone biosynthetic processO-succinylbenzoate synthaseHydro-lyase activity 3.20.20.120 198 12 82 3.36 4.09
1o1zA00 75.50 Thermotoga maritimaGlycerophospholipid metabolismGlycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]Putative uncharacterized protein 3.20.20.190 226 10 81 3.89 4.78
[1]
Displaying entries 1 to 30 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qgyA02
LPLNSLLTKSPKPNVPIYATCWSDLKKDTNDYLRQIEKFYGKKYGGIKIYPMLDSLSISIQFVEKVREIVGDELPLMLDL
AVPEDLDQTKSFLKEVSSFNPYWIEEPVDGENISLLTEIKNTFNMKVVTGEKQSGLVHFRELISRNAADIFNPDISGMGG
LIDIIEISNEASNNGIFISPHCWNSMSVSASAMLHVCSSIPNSEKAEIFPDYINFSKKFCELPFDIIDNKAHINKSAG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qgyA02
LPLNSLLTKSPKPNVPIYATCWSDLKKDTNDYLRQIEKFYGKKYGGIKIYPMLDSLSISIQFVEKVREIVGDELPLMLDL
AVPEDLDQTKSFLKEVSSFNPYWIEEPVDGENISLLTEIKNTFNMKVVTGEKQSGLVHFRELISRNAADIFNPDISGMGG
LIDIIEISNEASNNGIFISPHCWNSMSVSASAMLHVCSSIPNSEKAEIFPDYINFSKKFCELPFDIIDNKAHINKSAG
BLAST against CATH

[top]
Domain History Events (134)

Domain assigned by cuff on 18 Feb 2008 13:47

same superfamily

Domain assignment manual match h by tronnberg on 10 Dec 2007 14:22

SSAP: 86.7 OV: 94 SEQ: 20. The query's function is unknown.

Homcheck review by tronnberg on 10 Dec 2007 14:22

SSAP: 86.7 OV: 94 SEQ: 20. The query's function is unknown.

Flow stage update by tronnberg on 10 Dec 2007 14:22

SSAP: 86.7 OV: 94 SEQ: 20. The query's function is unknown.

Homcheck allotment by tronnberg on 10 Dec 2007 14:20

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 10 Dec 2007 14:20

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 09 Dec 2007 15:02

Domain "2qgyA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 09 Dec 2007 15:02

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qgyA02

Flow stage update by auto on 07 Dec 2007 19:55

Retrieved PRC_PFAMCATH results for job ID SID5531619270884296 and results inserted.

Domain scan prc pfamcath by auto on 07 Dec 2007 19:54

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 103 results for 2qgyA02

Update comment by auto on 07 Dec 2007 10:47

PRC_PFAMCATH job SID5531619270884296 is not yet finished.

Flow stage update by auto on 07 Dec 2007 10:43

The entry "2qgyA02" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 07 Dec 2007 10:43

The entry "2qgyA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Dec 2007 10:38

Retrieved SSAP results for job ID SID0208815727737696 and results inserted.

Domain scan ssap cath by auto on 07 Dec 2007 10:35

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 868 results for 2qgyA02

Update comment by auto on 05 Dec 2007 19:08

SSAP job SID0208815727737696 is not yet finished.

Ssap cath submit by auto on 05 Dec 2007 19:03

The entry "2qgyA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Dec 2007 19:03

The entry "2qgyA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Dec 2007 18:52

Retrieved PRC results for job ID SID5934545918882848 and inserted them into the database.

Domain scan prc cath by auto on 05 Dec 2007 18:51

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 44 results for 2qgyA02

Update comment by auto on 05 Dec 2007 15:05

PRC job SID5934545918882848 is not yet finished.

Flow stage update by auto on 05 Dec 2007 14:59

The entry "2qgyA02" has been submitted to the PRC webservice.

Prc cath submit by auto on 05 Dec 2007 14:59

The entry "2qgyA02" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Dec 2007 14:49

Retrieved HMM(SAM) results for job ID SID1315031463170176 and inserted them into the database.

Domain scan sam cath by auto on 05 Dec 2007 14:49

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 36 results for 2qgyA02

Update comment by auto on 05 Dec 2007 11:00

HMM(SAM) job SID1315031463170176 is not yet finished.

Sam cath submit by auto on 05 Dec 2007 10:55

The entry "2qgyA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 05 Dec 2007 10:55

The entry "2qgyA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 05 Dec 2007 10:43

Retrieved "2qgyA02" CATHEDRAL results for job ID SID7624999065647344 and inserted them into the database.

Domain scan cathedral cath by auto on 05 Dec 2007 10:43

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 130 results for 2qgyA02

Update comment by auto on 05 Dec 2007 06:37

"2qgyA02" CATHEDRAL job SID7624999065647344 is not yet finished.

Flow stage update by auto on 05 Dec 2007 06:31

The entry "2qgyA02" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 05 Dec 2007 06:31

The entry "2qgyA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 05 Dec 2007 03:28

Unable to insert the domain scan results from "2qgyA02" CATHEDRAL job SID1316115832250888.

Update comment by auto on 04 Dec 2007 23:02

"2qgyA02" CATHEDRAL job SID1316115832250888 is not yet finished.

Cathedral cath submit by auto on 04 Dec 2007 22:54

The entry "2qgyA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 04 Dec 2007 22:54

The entry "2qgyA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 04 Dec 2007 22:45

ScanList with 11650 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qgyA02.scanlist" for "2qgyA02"

Write scan list by auto on 04 Dec 2007 22:45

Writing ScanList containing 11650 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qgyA02.scanlist" for domain "2qgyA02"

Update comment by auto on 04 Dec 2007 18:15

Waiting for 43 new domains (example : 2z2eB00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 15:07

Waiting for 127 new domains (example : 2z2eB00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 10:15

Waiting for 206 new domains (example : 2vfzA00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 08:39

Waiting for 257 new domains (example : 2rb8A00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 02:36

Waiting for 335 new domains (example : 2r5qA00) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 22:42

Waiting for 410 new domains (example : 2qluA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 18:16

Waiting for 486 new domains (example : 2o2cB01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 14:51

Waiting for 559 new domains (example : 2ihuB03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 10:16

Waiting for 634 new domains (example : 2e2gJ02) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 07:39

Waiting for 665 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 02:42

Waiting for 642 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 22:33

Waiting for 633 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 18:28

Waiting for 582 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 16:55

Waiting for 555 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 10:15

Waiting for 492 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 07:10

Waiting for 574 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 22:15

Waiting for 624 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 18:53

Waiting for 698 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 14:15

Waiting for 787 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 11:43

Waiting for 869 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 06:28

Waiting for 942 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 02:30

Waiting for 1001 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 23:27

Waiting for 1059 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 18:18

Waiting for 1133 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 14:50

Waiting for 1234 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 10:39

Waiting for 1324 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 08:18

Waiting for 1411 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Nov 2007 22:10

Waiting for 1402 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Nov 2007 11:06

Waiting for 1512 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 29 Nov 2007 10:33

Moving these domains back to write scan list as we want to avoid any problems caused by the remediation that occurred whilst they were progressing through their scans.

Update comment by auto on 28 Nov 2007 22:36

PRC_PFAMCATH job SID8872837451006768 is not yet finished.

Prc pfamcath submit by auto on 28 Nov 2007 22:31

The entry "2qgyA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 28 Nov 2007 22:31

The entry "2qgyA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 28 Nov 2007 18:49

Unable to retrieve "2qgyA02" PRC_PFAMCATH results for job "SID7112717954581784"

Update comment by auto on 27 Nov 2007 14:35

PRC_PFAMCATH job SID7112717954581784 is not yet finished.

Prc pfamcath submit by auto on 27 Nov 2007 14:31

The entry "2qgyA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 27 Nov 2007 14:31

The entry "2qgyA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 27 Nov 2007 10:58

Unable to retrieve "2qgyA02" PRC_PFAMCATH results for job "SID7690059684624432"

Update comment by auto on 24 Nov 2007 22:34

PRC_PFAMCATH job SID7690059684624432 is not yet finished.

Prc pfamcath submit by auto on 24 Nov 2007 22:30

The entry "2qgyA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 24 Nov 2007 22:30

The entry "2qgyA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 24 Nov 2007 21:17

Giving up on PRC_PFAMCATH job SID7754029759715080 because submission time of Tue Nov 20 18:32:55 2007 is more than 345600 seconds older than current time (Sat Nov 24 21:17:23 2007).

Update comment by auto on 20 Nov 2007 18:35

PRC_PFAMCATH job SID7754029759715080 is not yet finished.

Prc pfamcath submit by auto on 20 Nov 2007 18:32

The entry "2qgyA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 20 Nov 2007 18:32

The entry "2qgyA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 20 Nov 2007 18:29

Retrieved SSAP results for job ID SID5328098400175160 and results inserted.

Domain scan ssap cath by auto on 20 Nov 2007 18:27

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 835 results for 2qgyA02

Update comment by auto on 17 Nov 2007 18:20

SSAP job SID5328098400175160 is not yet finished.

Ssap cath submit by auto on 17 Nov 2007 18:14

The entry "2qgyA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 17 Nov 2007 18:14

The entry "2qgyA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 17 Nov 2007 14:18

Giving up on SSAP job SID1269923320845056 because submission time of Tue Nov 13 12:01:51 2007 is more than 345600 seconds older than current time (Sat Nov 17 14:18:44 2007).

Update comment by auto on 13 Nov 2007 12:06

SSAP job SID1269923320845056 is not yet finished.

Ssap cath submit by auto on 13 Nov 2007 12:01

The entry "2qgyA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 13 Nov 2007 12:01

The entry "2qgyA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 13 Nov 2007 00:52

Unable to retrieve "2qgyA02" SSAP results for job "SID9055267906407360"

Update comment by auto on 15 Sep 2007 14:30

SSAP job SID9055267906407360 is not yet finished.

Ssap cath submit by auto on 15 Sep 2007 14:21

The entry "2qgyA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 14:21

The entry "2qgyA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 08:29

Giving up on SSAP job SID2837843698307312 because submission time of Sun Sep 9 22:55:11 2007 is more than 345600 seconds older than current time (Sat Sep 15 08:29:45 2007).

Update comment by auto on 09 Sep 2007 23:32

SSAP job SID2837843698307312 is not yet finished.

Flow stage update by auto on 09 Sep 2007 22:55

The entry "2qgyA02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 09 Sep 2007 22:55

The entry "2qgyA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:26

Giving up on SSAP job SID9169967374493408 because submission time of Wed Sep 5 19:05:15 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:26:01 2007).

Update comment by auto on 05 Sep 2007 20:08

SSAP job SID9169967374493408 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 19:05

The entry "2qgyA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 19:05

The entry "2qgyA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 15:01

Retrieved PRC results for job ID SID1067385568737920 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 15:00

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 41 results for 2qgyA02

Flow stage update by auto on 05 Sep 2007 04:42

The entry "2qgyA02" has been submitted to the PRC webservice.

Prc cath submit by auto on 05 Sep 2007 04:42

The entry "2qgyA02" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 02:39

Retrieved HMM(SAM) results for job ID SID4716151264718103 and inserted them into the database.

Domain scan sam cath by auto on 05 Sep 2007 02:38

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 34 results for 2qgyA02

Update comment by auto on 04 Sep 2007 13:33

HMM(SAM) job SID4716151264718103 is not yet finished.

Flow stage update by auto on 04 Sep 2007 10:41

The entry "2qgyA02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Sep 2007 10:41

The entry "2qgyA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 08:44

Retrieved "2qgyA02" CATHEDRAL results for job ID SID2529576024352809 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 08:43

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 129 results for 2qgyA02

Cathedral cath submit by auto on 03 Sep 2007 14:41

The entry "2qgyA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:41

The entry "2qgyA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 13:00

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qgyA02.scanlist" for "2qgyA02"

Write scan list by auto on 03 Sep 2007 13:00

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qgyA02.scanlist" for domain "2qgyA02"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:33

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:33

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:23

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:23

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:17

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:30

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 02 Sep 2007 02:24

No satisfactory AssignClose result found.

Flow stage update by auto on 02 Sep 2007 02:10

No in_process hits for Domain "2qgyA02" ready to be processed

Flow stage update by auto on 02 Sep 2007 02:10

NW result present for Domain "2qgyA02"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2qgyA02"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2qgyA02"

Insertion by cuff on 23 Aug 2007 14:44

nice chopping