Domain assigned by cuff on 14 May 2008 11:54
same superfamily
CATH Domain: 2qgsB01
2qgsB01
PDB 2qgs, Chain B, Domain 1
Segment boundaries for domain 2qgsB01
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2qgsB01 | 2 | 99 |
| 2qgsB02 | 109 | 217 |
Structural Neighbourhood (2 entries)
There are 2 matching structural neighberhood comparisons for CATH ID 1.10.472.50.1.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 2 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
2pjqA01 | 90.40 | 1.10.472.50 | 89 | 23 | 95 | 1.83 | 1.92 | |
|
3djbA01 | 89.68 | 1.10.472.50 | 93 | 31 | 89 | 1.75 | 1.96 |
[1]
Displaying entries 1 to 2 (page 1 of 1)
Domain ATOM Sequence
>pdb|2qgsB01 NSRKIKKAYEYKSFHQHDTTGHDIAHVERVYNNACYIAKRENITDTLVIELSSLLHDTVYDQLKQFLSTLDLSSEISQQV LYIIKH
Domain History Events (152)
Domain assignment manual match h by cuff on 14 May 2008 11:52
great scores, same superfamily
Domain assignment manual match t by tronnberg on 10 Dec 2007 14:07
SSAP: 75.3 OV: 72 SEQ: 6. The query's function is unknown.
Homcheck review by tronnberg on 10 Dec 2007 14:07
SSAP: 75.3 OV: 72 SEQ: 6. The query's function is unknown.
Flow stage update by tronnberg on 10 Dec 2007 14:07
SSAP: 75.3 OV: 72 SEQ: 6. The query's function is unknown.
Homcheck allotment by tronnberg on 10 Dec 2007 14:03
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 10 Dec 2007 14:03
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 09 Dec 2007 15:00
Domain "2qgsB01" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 09 Dec 2007 15:00
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qgsB01
Flow stage update by auto on 07 Dec 2007 14:58
Retrieved PRC_PFAMCATH results for job ID SID0379841428303024 and results inserted.
Domain scan prc pfamcath by auto on 07 Dec 2007 14:57
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 28 results for 2qgsB01
Update comment by auto on 06 Dec 2007 06:45
PRC_PFAMCATH job SID0379841428303024 is not yet finished.
Prc pfamcath submit by auto on 06 Dec 2007 06:44
The entry "2qgsB01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 06 Dec 2007 06:44
The entry "2qgsB01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 06 Dec 2007 06:36
Retrieved SSAP results for job ID SID1150448013037464 and results inserted.
Domain scan ssap cath by auto on 06 Dec 2007 06:31
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 3172 results for 2qgsB01
Update comment by auto on 05 Dec 2007 19:07
SSAP job SID1150448013037464 is not yet finished.
Ssap cath submit by auto on 05 Dec 2007 19:02
The entry "2qgsB01" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Dec 2007 19:02
The entry "2qgsB01" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Dec 2007 18:49
Retrieved PRC results for job ID SID6484244940905856 and inserted them into the database.
Domain scan prc cath by auto on 05 Dec 2007 18:49
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 10 results for 2qgsB01
Update comment by auto on 05 Dec 2007 15:04
PRC job SID6484244940905856 is not yet finished.
Prc cath submit by auto on 05 Dec 2007 14:57
The entry "2qgsB01" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Dec 2007 14:57
The entry "2qgsB01" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Dec 2007 14:46
Retrieved HMM(SAM) results for job ID SID5276036798617216 and inserted them into the database.
Domain scan sam cath by auto on 05 Dec 2007 14:46
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 4 results for 2qgsB01
Update comment by auto on 05 Dec 2007 11:00
HMM(SAM) job SID5276036798617216 is not yet finished.
Sam cath submit by auto on 05 Dec 2007 10:54
The entry "2qgsB01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 05 Dec 2007 10:54
The entry "2qgsB01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 05 Dec 2007 10:39
Retrieved "2qgsB01" CATHEDRAL results for job ID SID7278218697096960 and inserted them into the database.
Domain scan cathedral cath by auto on 05 Dec 2007 10:39
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 50 results for 2qgsB01
Update comment by auto on 05 Dec 2007 03:23
"2qgsB01" CATHEDRAL job SID7278218697096960 is not yet finished.
Cathedral cath submit by auto on 05 Dec 2007 03:05
The entry "2qgsB01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 05 Dec 2007 03:05
The entry "2qgsB01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 04 Dec 2007 23:01
Unable to insert the domain scan results from "2qgsB01" CATHEDRAL job SID1827209736715477.
Cathedral cath submit by auto on 04 Dec 2007 22:53
The entry "2qgsB01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 04 Dec 2007 22:53
The entry "2qgsB01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 04 Dec 2007 22:43
ScanList with 11650 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qgsB01.scanlist" for "2qgsB01"
Write scan list by auto on 04 Dec 2007 22:43
Writing ScanList containing 11650 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qgsB01.scanlist" for domain "2qgsB01"
Update comment by auto on 04 Dec 2007 18:15
Waiting for 43 new domains (example : 2z2eB00) to be processed so that they can be scanned against too.
Update comment by auto on 04 Dec 2007 15:07
Waiting for 127 new domains (example : 2z2eB00) to be processed so that they can be scanned against too.
Update comment by auto on 04 Dec 2007 10:15
Waiting for 206 new domains (example : 2vfzA00) to be processed so that they can be scanned against too.
Update comment by auto on 04 Dec 2007 08:39
Waiting for 257 new domains (example : 2rb8A00) to be processed so that they can be scanned against too.
Update comment by auto on 04 Dec 2007 02:36
Waiting for 335 new domains (example : 2r5qA00) to be processed so that they can be scanned against too.
Update comment by auto on 03 Dec 2007 22:42
Waiting for 410 new domains (example : 2qluA01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Dec 2007 18:15
Waiting for 486 new domains (example : 2o2cB01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Dec 2007 14:51
Waiting for 559 new domains (example : 2ihuB03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Dec 2007 10:16
Waiting for 634 new domains (example : 2e2gJ02) to be processed so that they can be scanned against too.
Update comment by auto on 03 Dec 2007 07:39
Waiting for 665 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 03 Dec 2007 02:42
Waiting for 642 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2007 22:33
Waiting for 633 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2007 18:28
Waiting for 582 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2007 16:54
Waiting for 555 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2007 10:15
Waiting for 492 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2007 07:10
Waiting for 574 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2007 22:15
Waiting for 624 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2007 18:53
Waiting for 698 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2007 14:15
Waiting for 787 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2007 11:43
Waiting for 869 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2007 06:27
Waiting for 942 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2007 02:30
Waiting for 1001 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 30 Nov 2007 23:27
Waiting for 1059 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 30 Nov 2007 18:17
Waiting for 1133 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 30 Nov 2007 14:50
Waiting for 1234 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 30 Nov 2007 10:39
Waiting for 1324 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 30 Nov 2007 08:18
Waiting for 1411 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 29 Nov 2007 22:10
Waiting for 1402 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 29 Nov 2007 11:06
Waiting for 1512 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Flow stage update by auto on 29 Nov 2007 10:33
Moving these domains back to write scan list as we want to avoid any problems caused by the remediation that occurred whilst they were progressing through their scans.
Update comment by auto on 28 Nov 2007 22:35
PRC_PFAMCATH job SID0344568379855936 is not yet finished.
Prc pfamcath submit by auto on 28 Nov 2007 22:30
The entry "2qgsB01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 28 Nov 2007 22:30
The entry "2qgsB01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 28 Nov 2007 18:48
Unable to retrieve "2qgsB01" PRC_PFAMCATH results for job "SID4636701569037512"
Update comment by auto on 27 Nov 2007 22:31
PRC_PFAMCATH job SID4636701569037512 is not yet finished.
Flow stage update by auto on 27 Nov 2007 22:28
The entry "2qgsB01" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 27 Nov 2007 22:28
The entry "2qgsB01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 27 Nov 2007 20:06
Unable to retrieve "2qgsB01" PRC_PFAMCATH results for job "SID9479174679287744"
Update comment by auto on 24 Nov 2007 10:59
PRC_PFAMCATH job SID9479174679287744 is not yet finished.
Flow stage update by auto on 24 Nov 2007 10:55
The entry "2qgsB01" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 24 Nov 2007 10:55
The entry "2qgsB01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 24 Nov 2007 06:53
Giving up on PRC_PFAMCATH job SID2358397618055392 because submission time of Tue Nov 20 02:37:56 2007 is more than 345600 seconds older than current time (Sat Nov 24 06:53:47 2007).
Update comment by auto on 20 Nov 2007 02:39
PRC_PFAMCATH job SID2358397618055392 is not yet finished.
Flow stage update by auto on 20 Nov 2007 02:38
The entry "2qgsB01" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 20 Nov 2007 02:37
The entry "2qgsB01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 20 Nov 2007 02:25
Retrieved SSAP results for job ID SID7248706668274592 and results inserted.
Domain scan ssap cath by auto on 20 Nov 2007 02:20
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 3011 results for 2qgsB01
Update comment by auto on 18 Nov 2007 02:22
SSAP job SID7248706668274592 is not yet finished.
Ssap cath submit by auto on 18 Nov 2007 02:18
The entry "2qgsB01" has been submitted to the SSAP webservice.
Flow stage update by auto on 18 Nov 2007 02:18
The entry "2qgsB01" has been submitted to the SSAP webservice.
Flow stage update by auto on 17 Nov 2007 22:17
Giving up on SSAP job SID7988474511619136 because submission time of Tue Nov 13 22:12:17 2007 is more than 345600 seconds older than current time (Sat Nov 17 22:17:23 2007).
Update comment by auto on 13 Nov 2007 22:15
SSAP job SID7988474511619136 is not yet finished.
Flow stage update by auto on 13 Nov 2007 22:12
The entry "2qgsB01" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 13 Nov 2007 22:12
The entry "2qgsB01" has been submitted to the SSAP webservice.
Flow stage update by auto on 13 Nov 2007 18:38
Unable to retrieve "2qgsB01" SSAP results for job "SID3978801451728000"
Update comment by auto on 13 Nov 2007 12:05
SSAP job SID3978801451728000 is not yet finished.
Ssap cath submit by auto on 13 Nov 2007 12:00
The entry "2qgsB01" has been submitted to the SSAP webservice.
Flow stage update by auto on 13 Nov 2007 12:00
The entry "2qgsB01" has been submitted to the SSAP webservice.
Flow stage update by auto on 13 Nov 2007 00:50
Unable to retrieve "2qgsB01" SSAP results for job "SID7941012410233600"
Update comment by auto on 15 Sep 2007 14:30
SSAP job SID7941012410233600 is not yet finished.
Ssap cath submit by auto on 15 Sep 2007 14:22
The entry "2qgsB01" has been submitted to the SSAP webservice.
Flow stage update by auto on 15 Sep 2007 14:22
The entry "2qgsB01" has been submitted to the SSAP webservice.
Flow stage update by auto on 15 Sep 2007 08:30
Giving up on SSAP job SID8212032552800464 because submission time of Sun Sep 9 22:56:10 2007 is more than 345600 seconds older than current time (Sat Sep 15 08:30:31 2007).
Update comment by auto on 09 Sep 2007 23:33
SSAP job SID8212032552800464 is not yet finished.
Ssap cath submit by auto on 09 Sep 2007 22:56
The entry "2qgsB01" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 22:56
The entry "2qgsB01" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 20:27
Giving up on SSAP job SID9790382369436880 because submission time of Wed Sep 5 19:06:14 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:27:04 2007).
Update comment by auto on 05 Sep 2007 20:09
SSAP job SID9790382369436880 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 19:06
The entry "2qgsB01" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 19:06
The entry "2qgsB01" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 15:09
Retrieved PRC results for job ID SID3353527549384608 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 15:08
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 6 results for 2qgsB01
Prc cath submit by auto on 05 Sep 2007 04:43
The entry "2qgsB01" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 04:43
The entry "2qgsB01" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 02:46
Retrieved HMM(SAM) results for job ID SID7187683813196423 and inserted them into the database.
Domain scan sam cath by auto on 05 Sep 2007 02:45
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 2qgsB01
Update comment by auto on 04 Sep 2007 13:34
HMM(SAM) job SID7187683813196423 is not yet finished.
Flow stage update by auto on 04 Sep 2007 10:42
The entry "2qgsB01" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 04 Sep 2007 10:42
The entry "2qgsB01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 08:56
Retrieved "2qgsB01" CATHEDRAL results for job ID SID6869044100102784 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 08:55
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 53 results for 2qgsB01
Cathedral cath submit by auto on 03 Sep 2007 14:42
The entry "2qgsB01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 14:42
The entry "2qgsB01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 13:01
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qgsB01.scanlist" for "2qgsB01"
Write scan list by auto on 03 Sep 2007 13:01
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qgsB01.scanlist" for domain "2qgsB01"
Update comment by auto on 03 Sep 2007 10:11
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:33
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:38
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:33
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:23
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:23
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:17
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:30
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:14
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:16
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:17
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:42
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:17
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:34
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:08
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 16:18
Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 10:13
Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 06:33
Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 02:38
Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 22:17
Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 14:43
Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 09:06
Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Flow stage update by auto on 29 Aug 2007 06:27
No satisfactory AssignClose result found.
Flow stage update by auto on 29 Aug 2007 06:13
No in_process hits for Domain "2qgsB01" ready to be processed
Flow stage update by auto on 29 Aug 2007 06:13
NW result present for Domain "2qgsB01"
Flow stage update by auto on 21 Aug 2007 10:07
All required files are present for Domain "2qgsB01"
Flow stage update by auto on 20 Aug 2007 17:33
Beginning processing for Domain "2qgsB01"
Insertion by auto on 20 Aug 2007 14:29
Final ChopClose added based on similarity with "2pjqA"
