Domain assigned by cuff on 14 May 2008 11:54
same superfamily
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2qgsB01 | 2 | 99 |
| 2qgsB02 | 109 | 217 |
There are 2 matching structural neighberhood comparisons for CATH ID 1.10.472.50.1.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2pjqA01 | 90.40 | 1.10.472.50 | 89 | 23 | 95 | 1.83 | 1.92 | |
![]() |
3djbA01 | 89.68 | 1.10.472.50 | 93 | 31 | 89 | 1.75 | 1.96 |
>pdb|2qgsB01 NSRKIKKAYEYKSFHQHDTTGHDIAHVERVYNNACYIAKRENITDTLVIELSSLLHDTVYDQLKQFLSTLDLSSEISQQV LYIIKH
same superfamily
great scores, same superfamily
SSAP: 75.3 OV: 72 SEQ: 6. The query's function is unknown.
SSAP: 75.3 OV: 72 SEQ: 6. The query's function is unknown.
SSAP: 75.3 OV: 72 SEQ: 6. The query's function is unknown.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "2qgsB01" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qgsB01
Retrieved PRC_PFAMCATH results for job ID SID0379841428303024 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 28 results for 2qgsB01
PRC_PFAMCATH job SID0379841428303024 is not yet finished.
The entry "2qgsB01" has been submitted to the PRC_PFAMCATH webservice.
The entry "2qgsB01" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID1150448013037464 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 3172 results for 2qgsB01
SSAP job SID1150448013037464 is not yet finished.
The entry "2qgsB01" has been submitted to the SSAP webservice.
The entry "2qgsB01" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID6484244940905856 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 10 results for 2qgsB01
PRC job SID6484244940905856 is not yet finished.
The entry "2qgsB01" has been submitted to the PRC webservice.
The entry "2qgsB01" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID5276036798617216 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 4 results for 2qgsB01
HMM(SAM) job SID5276036798617216 is not yet finished.
The entry "2qgsB01" has been submitted to the HMM (SAM) webservice.
The entry "2qgsB01" has been submitted to the HMM (SAM) webservice.
Retrieved "2qgsB01" CATHEDRAL results for job ID SID7278218697096960 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 50 results for 2qgsB01
"2qgsB01" CATHEDRAL job SID7278218697096960 is not yet finished.
The entry "2qgsB01" has been submitted to the CATHEDRAL webservice.
The entry "2qgsB01" has been submitted to the CATHEDRAL webservice.
Unable to insert the domain scan results from "2qgsB01" CATHEDRAL job SID1827209736715477.
The entry "2qgsB01" has been submitted to the CATHEDRAL webservice.
The entry "2qgsB01" has been submitted to the CATHEDRAL webservice.
ScanList with 11650 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qgsB01.scanlist" for "2qgsB01"
Writing ScanList containing 11650 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qgsB01.scanlist" for domain "2qgsB01"
Waiting for 43 new domains (example : 2z2eB00) to be processed so that they can be scanned against too.
Waiting for 127 new domains (example : 2z2eB00) to be processed so that they can be scanned against too.
Waiting for 206 new domains (example : 2vfzA00) to be processed so that they can be scanned against too.
Waiting for 257 new domains (example : 2rb8A00) to be processed so that they can be scanned against too.
Waiting for 335 new domains (example : 2r5qA00) to be processed so that they can be scanned against too.
Waiting for 410 new domains (example : 2qluA01) to be processed so that they can be scanned against too.
Waiting for 486 new domains (example : 2o2cB01) to be processed so that they can be scanned against too.
Waiting for 559 new domains (example : 2ihuB03) to be processed so that they can be scanned against too.
Waiting for 634 new domains (example : 2e2gJ02) to be processed so that they can be scanned against too.
Waiting for 665 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Waiting for 642 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Waiting for 633 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Waiting for 582 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Waiting for 555 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Waiting for 492 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Waiting for 574 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Waiting for 624 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Waiting for 698 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Waiting for 787 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Waiting for 869 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Waiting for 942 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Waiting for 1001 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Waiting for 1059 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Waiting for 1133 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Waiting for 1234 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Waiting for 1324 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Waiting for 1411 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Waiting for 1402 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Waiting for 1512 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Moving these domains back to write scan list as we want to avoid any problems caused by the remediation that occurred whilst they were progressing through their scans.
PRC_PFAMCATH job SID0344568379855936 is not yet finished.
The entry "2qgsB01" has been submitted to the PRC_PFAMCATH webservice.
The entry "2qgsB01" has been submitted to the PRC_PFAMCATH webservice.
Unable to retrieve "2qgsB01" PRC_PFAMCATH results for job "SID4636701569037512"
PRC_PFAMCATH job SID4636701569037512 is not yet finished.
The entry "2qgsB01" has been submitted to the PRC_PFAMCATH webservice.
The entry "2qgsB01" has been submitted to the PRC_PFAMCATH webservice.
Unable to retrieve "2qgsB01" PRC_PFAMCATH results for job "SID9479174679287744"
PRC_PFAMCATH job SID9479174679287744 is not yet finished.
The entry "2qgsB01" has been submitted to the PRC_PFAMCATH webservice.
The entry "2qgsB01" has been submitted to the PRC_PFAMCATH webservice.
Giving up on PRC_PFAMCATH job SID2358397618055392 because submission time of Tue Nov 20 02:37:56 2007 is more than 345600 seconds older than current time (Sat Nov 24 06:53:47 2007).
PRC_PFAMCATH job SID2358397618055392 is not yet finished.
The entry "2qgsB01" has been submitted to the PRC_PFAMCATH webservice.
The entry "2qgsB01" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID7248706668274592 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 3011 results for 2qgsB01
SSAP job SID7248706668274592 is not yet finished.
The entry "2qgsB01" has been submitted to the SSAP webservice.
The entry "2qgsB01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID7988474511619136 because submission time of Tue Nov 13 22:12:17 2007 is more than 345600 seconds older than current time (Sat Nov 17 22:17:23 2007).
SSAP job SID7988474511619136 is not yet finished.
The entry "2qgsB01" has been submitted to the SSAP webservice.
The entry "2qgsB01" has been submitted to the SSAP webservice.
Unable to retrieve "2qgsB01" SSAP results for job "SID3978801451728000"
SSAP job SID3978801451728000 is not yet finished.
The entry "2qgsB01" has been submitted to the SSAP webservice.
The entry "2qgsB01" has been submitted to the SSAP webservice.
Unable to retrieve "2qgsB01" SSAP results for job "SID7941012410233600"
SSAP job SID7941012410233600 is not yet finished.
The entry "2qgsB01" has been submitted to the SSAP webservice.
The entry "2qgsB01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID8212032552800464 because submission time of Sun Sep 9 22:56:10 2007 is more than 345600 seconds older than current time (Sat Sep 15 08:30:31 2007).
SSAP job SID8212032552800464 is not yet finished.
The entry "2qgsB01" has been submitted to the SSAP webservice.
The entry "2qgsB01" has been submitted to the SSAP webservice.
Giving up on SSAP job SID9790382369436880 because submission time of Wed Sep 5 19:06:14 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:27:04 2007).
SSAP job SID9790382369436880 is not yet finished.
The entry "2qgsB01" has been submitted to the SSAP webservice.
The entry "2qgsB01" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID3353527549384608 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 6 results for 2qgsB01
The entry "2qgsB01" has been submitted to the PRC webservice.
The entry "2qgsB01" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID7187683813196423 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 2qgsB01
HMM(SAM) job SID7187683813196423 is not yet finished.
The entry "2qgsB01" has been submitted to the HMM (SAM) webservice.
The entry "2qgsB01" has been submitted to the HMM (SAM) webservice.
Retrieved "2qgsB01" CATHEDRAL results for job ID SID6869044100102784 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 53 results for 2qgsB01
The entry "2qgsB01" has been submitted to the CATHEDRAL webservice.
The entry "2qgsB01" has been submitted to the CATHEDRAL webservice.
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qgsB01.scanlist" for "2qgsB01"
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qgsB01.scanlist" for domain "2qgsB01"
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "2qgsB01" ready to be processed
NW result present for Domain "2qgsB01"
All required files are present for Domain "2qgsB01"
Beginning processing for Domain "2qgsB01"
Final ChopClose added based on similarity with "2pjqA"