CATH Domain: 2qggA01 XML data for domain: 2qggA01

Molscript image for 2qggA01
2qggA01
PDB coordinates for domain 2qggA01

PDB 2qgg, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.40 Beta Barrel
2.40.30 Elongation Factor Tu (Ef-tu); domain 3
2.40.30.60 RimM N-terminal domain-like Gene3D
2.40.30.60.1
2.40.30.60.1.1
2.40.30.60.1.1.1
2.40.30.60.1.1.1.1
2.40.30.60.1.1.1.1.1

[top]
Segment boundaries for domain 2qggA01

Chopping figure for domain 2qggA01
DomainStart PDB ResidueStop PDB Residue
2qggA01 6 98
2qggA02 99 181

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 2.40.30.60.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ck3D01 76.88 ATP catabolic processParkinson's diseaseOxidative phosphorylationAlzheimer's diseaseMetabolic pathways 2.40.10.170 73 8 78 3.43 4.40
1wb1A04 73.59 Methanococcus maripaludisMJ0495-like protein 2.40.10.190 79 5 81 3.87 4.76
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qggA01
NVPEDRIQIGQLRSAYGLNGWLWVYSNTEPSNFDYLPWYIETKAGWQTVDVKRWKPHGKGLVVSLKGVSDRTGAESLVAS
NIWIAKSQLPK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qggA01
XTPTQNVPEDRIQIGQLRSAYGLNGWLWVYSNTEPXSNXFDYLPWYIETKAGWQTVDVKRWKPHGKGLVVSLKGVSDRTG
AESLVASNIWIAKSQLPK
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 13 Nov 2007 00:27

Assigning to "2.40.30.60" based on similarity with "2f1lA01"

Flow stage update by auto on 13 Nov 2007 00:13

No in_process hits for Domain "2qggA01" ready to be processed

Update comment by auto on 03 Sep 2007 20:10

Domain "2qggA01" hits Domain "2f1lA01" (35.9550561797753% over 90.8163265306122%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2qggA01" hits Domain "2f1lA01" (35.9550561797753% over 90.8163265306122%) which is currently in process

Update comment by auto on 02 Sep 2007 02:11

Domain "2qggA01" hits Domain "2f1lA01" (35.9550561797753% over 90.8163265306122%) which is currently in process

Flow stage update by auto on 02 Sep 2007 02:10

Domain "2qggA01" hits Domain "2f1lA01" (35.9550561797753% over 90.8163265306122%) which is currently in process

Flow stage update by auto on 02 Sep 2007 02:10

NW result present for Domain "2qggA01"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2qggA01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2qggA01"

Insertion by cuff on 23 Aug 2007 14:44

nice chopping