Domain assigned by cuff on 16 Mar 2009 17:38
same superfamily
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2qgaB01 | 1 | 114 |
| 2qgaB02 | 115 | 379 |
| 2qgaB02 | 446 | 461 |
| 2qgaB03 | 380 | 445 |
There are 4 matching structural neighberhood comparisons for CATH ID 1.10.275.10.6.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1c3cA01 | 81.09 | 1.10.275.10 | 91 | 20 | 76 | 3.05 | 4.00 | |
![]() |
1dofA02 | 80.62 | 1.10.275.10 | 85 | 24 | 71 | 2.56 | 3.60 | |
![]() |
3c8tA01 | 79.97 | 1.10.275.10 | 97 | 13 | 81 | 3.72 | 4.56 | |
![]() |
1q5nA01 | 79.12 | 1.10.275.10 | 99 | 11 | 78 | 3.78 | 4.84 |
>pdb|2qgaB01 EHLKNISPIDGRYKKACGELSAFFSEHALIKHRIIVEVRWLLFLNEEELFFEKVTDHSVEVLNQIATNITDSDIARVKAI EEETNHDVKAVEYFVKEKLKNSKREDLLKIKEYV
same superfamily
homology match
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "2qgaB01" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qgaB01
Retrieved PRC_PFAMCATH results for job ID SID4320551472455424 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 15 results for 2qgaB01
PRC_PFAMCATH job SID4320551472455424 is not yet finished.
The entry "2qgaB01" has been submitted to the PRC_PFAMCATH webservice.
The entry "2qgaB01" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID1899205912584352 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 3332 results for 2qgaB01
SSAP job SID1899205912584352 is not yet finished.
The entry "2qgaB01" has been submitted to the SSAP webservice.
The entry "2qgaB01" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID1882819359527648 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 7 results for 2qgaB01
PRC job SID1882819359527648 is not yet finished.
The entry "2qgaB01" has been submitted to the PRC webservice.
The entry "2qgaB01" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID3277112410017664 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 4 results for 2qgaB01
HMM(SAM) job SID3277112410017664 is not yet finished.
The entry "2qgaB01" has been submitted to the HMM (SAM) webservice.
The entry "2qgaB01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2qgaB01" HMM(SAM) results for job "SID7455003226200432"
HMM(SAM) job SID7455003226200432 is not yet finished.
The entry "2qgaB01" has been submitted to the HMM (SAM) webservice.
The entry "2qgaB01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2qgaB01" HMM(SAM) results for job "SID4991492131518336"
The entry "2qgaB01" has been submitted to the HMM (SAM) webservice.
The entry "2qgaB01" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2qgaB01" HMM(SAM) results for job "SID8840376825180960"
HMM(SAM) job SID8840376825180960 is not yet finished.
The entry "2qgaB01" has been submitted to the HMM (SAM) webservice.
The entry "2qgaB01" has been submitted to the HMM (SAM) webservice.
Retrieved "2qgaB01" CATHEDRAL results for job ID SID0813749143043864 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 244 results for 2qgaB01
The entry "2qgaB01" has been submitted to the CATHEDRAL webservice.
The entry "2qgaB01" has been submitted to the CATHEDRAL webservice.
Unable to retrieve "2qgaB01" CATHEDRAL results for job "SID9015082383723480"
"2qgaB01" CATHEDRAL job SID9015082383723480 is not yet finished.
The entry "2qgaB01" has been submitted to the CATHEDRAL webservice.
The entry "2qgaB01" has been submitted to the CATHEDRAL webservice.
ScanList with 12830 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qgaB01.scanlist" for "2qgaB01"
Writing ScanList containing 12830 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qgaB01.scanlist" for domain "2qgaB01"
Waiting for 76 new domains (example : 3davB00) to be processed so that they can be scanned against too.
Waiting for 113 new domains (example : 3bmkB00) to be processed so that they can be scanned against too.
Waiting for 148 new domains (example : 3bllA00) to be processed so that they can be scanned against too.
Waiting for 197 new domains (example : 2vmtA02) to be processed so that they can be scanned against too.
Waiting for 239 new domains (example : 2jknF00) to be processed so that they can be scanned against too.
Waiting for 256 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Waiting for 248 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Waiting for 246 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Waiting for 197 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Waiting for 189 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.
Waiting for 32 new domains (example : 2jknA00) to be processed so that they can be scanned against too.
Waiting for 2 new domains (example : 3fcxA00) to be processed so that they can be scanned against too.
Waiting for 27 new domains (example : 3ex7B00) to be processed so that they can be scanned against too.
Waiting for 80 new domains (example : 2zecD01) to be processed so that they can be scanned against too.
Waiting for 132 new domains (example : 2zebD01) to be processed so that they can be scanned against too.
Waiting for 174 new domains (example : 2zebD01) to be processed so that they can be scanned against too.
Waiting for 227 new domains (example : 2w42B01) to be processed so that they can be scanned against too.
Waiting for 270 new domains (example : 2rklB00) to be processed so that they can be scanned against too.
Waiting for 285 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Waiting for 267 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Waiting for 261 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Waiting for 215 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Waiting for 201 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Waiting for 150 new domains (example : 2jldA01) to be processed so that they can be scanned against too.
Waiting for 297 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Waiting for 337 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Waiting for 547 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Waiting for 598 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Waiting for 852 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Waiting for 902 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.
Waiting for 1430 new domains (example : 2nrfA00) to be processed so that they can be scanned against too.
Waiting for 1534 new domains (example : 2gqgA02) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "2qgaB01" ready to be processed
NW result present for Domain "2qgaB01"
All required files are present for Domain "2qgaB01"
Beginning processing for Domain "2qgaB01"
Final ChopClose added based on similarity with "2hvgA"