CATH Domain: 2qgaB01 XML data for domain: 2qgaB01

Molscript image for 2qgaB01
2qgaB01
PDB coordinates for domain 2qgaB01

PDB 2qga, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.275 Fumarase C; Chain B, domain 1
1.10.275.10 Fumarase/aspartase (N-terminal domain) Gene3D
1.10.275.10.6
1.10.275.10.6.1
1.10.275.10.6.1.1
1.10.275.10.6.1.1.1
1.10.275.10.6.1.1.1.1

[top]
Segment boundaries for domain 2qgaB01

Chopping figure for domain 2qgaB01
DomainStart PDB ResidueStop PDB Residue
2qgaB01 1 114
2qgaB02 115 379
2qgaB02 446 461
2qgaB03 380 445

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 1.10.275.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1c3cA01 81.09 Thermotoga maritimaAdenylosuccinate lyaseAdenylosuccinate lyase [EC:4.3.2.2]Purine metabolismAlanine, aspartate and glutamate metabolism 1.10.275.10 91 20 76 3.05 4.00
1dofA02 80.62 Pyrobaculum aerophilumAdenylosuccinate lyase [EC:4.3.2.2]Purine metabolismAdenylosuccinate lyase (PurB)Alanine, aspartate and glutamate metabolism 1.10.275.10 85 24 71 2.56 3.60
3c8tA01 79.97 Chelativorans sp. BNC1Fumarate lyaseBenzoate degradation via hydroxylation3-carboxy-cis,cis-muconate cycloisomerase [EC:5.5.1.2]Metabolic pathways 1.10.275.10 97 13 81 3.72 4.56
1q5nA01 79.12 3-carboxy-cis,cis-muconate cycloisomeraseBenzoate degradation via hydroxylation3-carboxy-cis,cis-muconate cycloisomerase [EC:5.5.1.2]Metabolic pathwaysAcinetobacter sp. ADP1 1.10.275.10 99 11 78 3.78 4.84
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qgaB01
EHLKNISPIDGRYKKACGELSAFFSEHALIKHRIIVEVRWLLFLNEEELFFEKVTDHSVEVLNQIATNITDSDIARVKAI
EEETNHDVKAVEYFVKEKLKNSKREDLLKIKEYV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qgaB01
GSEHLKNISPIDGRYKKACGELSAFFSEHALIKHRIIVEVRWLLFLNEEELFFEKVTDHSVEVLNQIATNITDSDIARVK
AIEEETNHDVKAVEYFVKEKLKNSKREDLLKIKEYV
BLAST against CATH

[top]
Domain History Events (85)

Domain assigned by cuff on 16 Mar 2009 17:38

same superfamily

Domain assignment manual match h by cuff on 16 Mar 2009 17:36

homology match

Homcheck allotment by cuff on 16 Mar 2009 17:34

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 16 Mar 2009 17:34

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 16 Mar 2009 06:11

Domain "2qgaB01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 16 Mar 2009 06:11

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qgaB01

Flow stage update by auto on 16 Mar 2009 02:37

Retrieved PRC_PFAMCATH results for job ID SID4320551472455424 and results inserted.

Domain scan prc pfamcath by auto on 16 Mar 2009 02:36

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 15 results for 2qgaB01

Update comment by auto on 13 Mar 2009 22:25

PRC_PFAMCATH job SID4320551472455424 is not yet finished.

Prc pfamcath submit by auto on 13 Mar 2009 22:22

The entry "2qgaB01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 13 Mar 2009 22:22

The entry "2qgaB01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 13 Mar 2009 22:03

Retrieved SSAP results for job ID SID1899205912584352 and results inserted.

Domain scan ssap cath by auto on 13 Mar 2009 21:57

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 3332 results for 2qgaB01

Update comment by auto on 10 Mar 2009 02:29

SSAP job SID1899205912584352 is not yet finished.

Ssap cath submit by auto on 10 Mar 2009 02:15

The entry "2qgaB01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Mar 2009 02:15

The entry "2qgaB01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Mar 2009 01:01

Retrieved PRC results for job ID SID1882819359527648 and inserted them into the database.

Domain scan prc cath by auto on 10 Mar 2009 01:00

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 7 results for 2qgaB01

Update comment by auto on 09 Mar 2009 19:54

PRC job SID1882819359527648 is not yet finished.

Flow stage update by auto on 09 Mar 2009 19:34

The entry "2qgaB01" has been submitted to the PRC webservice.

Prc cath submit by auto on 09 Mar 2009 19:34

The entry "2qgaB01" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Mar 2009 18:28

Retrieved HMM(SAM) results for job ID SID3277112410017664 and inserted them into the database.

Domain scan sam cath by auto on 09 Mar 2009 18:28

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 4 results for 2qgaB01

Update comment by auto on 04 Mar 2009 16:06

HMM(SAM) job SID3277112410017664 is not yet finished.

Sam cath submit by auto on 04 Mar 2009 15:53

The entry "2qgaB01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 15:53

The entry "2qgaB01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 12:33

Unable to retrieve "2qgaB01" HMM(SAM) results for job "SID7455003226200432"

Update comment by auto on 04 Mar 2009 04:08

HMM(SAM) job SID7455003226200432 is not yet finished.

Sam cath submit by auto on 04 Mar 2009 03:54

The entry "2qgaB01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 03:54

The entry "2qgaB01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 00:30

Unable to retrieve "2qgaB01" HMM(SAM) results for job "SID4991492131518336"

Sam cath submit by auto on 03 Mar 2009 23:22

The entry "2qgaB01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Mar 2009 23:22

The entry "2qgaB01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 15:45

Unable to retrieve "2qgaB01" HMM(SAM) results for job "SID8840376825180960"

Update comment by auto on 19 Feb 2009 08:28

HMM(SAM) job SID8840376825180960 is not yet finished.

Sam cath submit by auto on 19 Feb 2009 07:59

The entry "2qgaB01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 07:59

The entry "2qgaB01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 07:05

Retrieved "2qgaB01" CATHEDRAL results for job ID SID0813749143043864 and inserted them into the database.

Domain scan cathedral cath by auto on 19 Feb 2009 07:04

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 244 results for 2qgaB01

Flow stage update by auto on 19 Feb 2009 06:15

The entry "2qgaB01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 19 Feb 2009 06:15

The entry "2qgaB01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 27 Jan 2009 11:52

Unable to retrieve "2qgaB01" CATHEDRAL results for job "SID9015082383723480"

Update comment by auto on 22 Jan 2009 17:04

"2qgaB01" CATHEDRAL job SID9015082383723480 is not yet finished.

Flow stage update by auto on 22 Jan 2009 16:23

The entry "2qgaB01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 22 Jan 2009 16:23

The entry "2qgaB01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 21 Dec 2008 14:46

ScanList with 12830 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qgaB01.scanlist" for "2qgaB01"

Write scan list by auto on 21 Dec 2008 14:46

Writing ScanList containing 12830 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qgaB01.scanlist" for domain "2qgaB01"

Update comment by auto on 21 Dec 2008 11:52

Waiting for 76 new domains (example : 3davB00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 20:41

Waiting for 113 new domains (example : 3bmkB00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 19:04

Waiting for 148 new domains (example : 3bllA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 14:35

Waiting for 197 new domains (example : 2vmtA02) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 11:35

Waiting for 239 new domains (example : 2jknF00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 07:49

Waiting for 256 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 03:58

Waiting for 248 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 00:49

Waiting for 246 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 20:42

Waiting for 197 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 16:55

Waiting for 189 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 11:34

Waiting for 32 new domains (example : 2jknA00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 23:33

Waiting for 2 new domains (example : 3fcxA00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 22:12

Waiting for 27 new domains (example : 3ex7B00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 17:37

Waiting for 80 new domains (example : 2zecD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 14:52

Waiting for 132 new domains (example : 2zebD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 11:32

Waiting for 174 new domains (example : 2zebD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 09:47

Waiting for 227 new domains (example : 2w42B01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 04:24

Waiting for 270 new domains (example : 2rklB00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 00:27

Waiting for 285 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 20:35

Waiting for 267 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 18:32

Waiting for 261 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 14:43

Waiting for 215 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 10:54

Waiting for 201 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Dec 2008 20:40

Waiting for 150 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Dec 2008 17:13

Waiting for 297 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Dec 2008 20:41

Waiting for 337 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Dec 2008 17:18

Waiting for 547 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Dec 2008 20:37

Waiting for 598 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Dec 2008 16:50

Waiting for 852 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Dec 2008 20:55

Waiting for 902 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Dec 2008 17:05

Waiting for 1430 new domains (example : 2nrfA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Dec 2008 14:48

Waiting for 1534 new domains (example : 2gqgA02) to be processed so that they can be scanned against too.

Flow stage update by auto on 10 Dec 2008 14:38

No satisfactory AssignClose result found.

Flow stage update by auto on 10 Dec 2008 14:17

No in_process hits for Domain "2qgaB01" ready to be processed

Flow stage update by auto on 10 Dec 2008 14:17

NW result present for Domain "2qgaB01"

Flow stage update by auto on 10 Dec 2008 14:15

All required files are present for Domain "2qgaB01"

Flow stage update by auto on 10 Dec 2008 14:14

Beginning processing for Domain "2qgaB01"

Insertion by auto on 05 Dec 2008 17:14

Final ChopClose added based on similarity with "2hvgA"