CATH Domain: 2qf9A01 XML data for domain: 2qf9A01

Molscript image for 2qf9A01
2qf9A01
PDB coordinates for domain 2qf9A01

PDB 2qf9, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1260 Ferritin;
1.20.1260.10 Gene3D
1.20.1260.10.14
1.20.1260.10.14.1
1.20.1260.10.14.1.1
1.20.1260.10.14.1.1.1
1.20.1260.10.14.1.1.1.1

[top]
Segment boundaries for domain 2qf9A01

Chopping figure for domain 2qf9A01
DomainStart PDB ResidueStop PDB Residue
2qf9A01 38 203

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.20.1260.10.14.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2qqyA00 84.67 Bacillus anthracisBacterioferritinPutative uncharacterized protein 1.20.1260.10 133 3 86 3.54 4.10
2oh3A01 81.91 Magnetospirillum magneticum AMB-1Uncharacterized conserved protein 1.20.1260.10 132 11 89 4.38 4.91
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qf9A01
AADSADAGFARDSVHHQQAVESYIVRDRTDDEEVRRLAYDIAQTQANQRGIGWLDLWALPKVSSDPPTWGGPGATDAEKK
LGTLDGKQAEVYYLQLTEHHRGGVHAKGCVERCTVGVEKRLARGVESQESEIRLADLLAERG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qf9A01
XSLAADSADAGFARDXSVHHQQAVEXSYIVRDRTDDEEVRRLAYDIAQTQANQRGXXIGWLDLWALPKVSSDPPXTWXGX
GDAPSAGEGSLXPGXATDAEXKKLGTLDGKQAEVYYLQLXTEHHRGGVHXAKGCVERCTVGVEKRLARGXVESQESEIRL
XADLLAERG
BLAST against CATH

[top]
Domain History Events (138)

Domain assigned by cuff on 18 Feb 2008 13:56

same superfamily

Domain assignment manual match h by tronnberg on 10 Dec 2007 13:09

SSAP: 85.0 OV: 88 SEQ: 4

Homcheck review by tronnberg on 10 Dec 2007 13:09

SSAP: 85.0 OV: 88 SEQ: 4

Flow stage update by tronnberg on 10 Dec 2007 13:09

SSAP: 85.0 OV: 88 SEQ: 4

Homcheck allotment by tronnberg on 10 Dec 2007 12:20

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 10 Dec 2007 12:20

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 09 Dec 2007 15:00

Domain "2qf9A01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 09 Dec 2007 15:00

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qf9A01

Flow stage update by auto on 07 Dec 2007 14:57

Retrieved PRC_PFAMCATH results for job ID SID0208658772608498 and results inserted.

Domain scan prc pfamcath by auto on 07 Dec 2007 14:57

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2qf9A01

Update comment by auto on 06 Dec 2007 14:57

PRC_PFAMCATH job SID0208658772608498 is not yet finished.

Prc pfamcath submit by auto on 06 Dec 2007 14:55

The entry "2qf9A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Dec 2007 14:55

The entry "2qf9A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Dec 2007 14:39

Retrieved SSAP results for job ID SID7011472323852752 and results inserted.

Domain scan ssap cath by auto on 06 Dec 2007 14:37

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1479 results for 2qf9A01

Update comment by auto on 05 Dec 2007 19:07

SSAP job SID7011472323852752 is not yet finished.

Ssap cath submit by auto on 05 Dec 2007 19:01

The entry "2qf9A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Dec 2007 19:01

The entry "2qf9A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Dec 2007 18:48

Retrieved PRC results for job ID SID8403439807116800 and inserted them into the database.

Domain scan prc cath by auto on 05 Dec 2007 18:48

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2qf9A01

Update comment by auto on 05 Dec 2007 15:04

PRC job SID8403439807116800 is not yet finished.

Prc cath submit by auto on 05 Dec 2007 14:57

The entry "2qf9A01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Dec 2007 14:57

The entry "2qf9A01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Dec 2007 14:46

Retrieved HMM(SAM) results for job ID SID0599146448464680 and inserted them into the database.

Domain scan sam cath by auto on 05 Dec 2007 14:46

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2qf9A01

Update comment by auto on 05 Dec 2007 11:00

HMM(SAM) job SID0599146448464680 is not yet finished.

Sam cath submit by auto on 05 Dec 2007 10:54

The entry "2qf9A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 05 Dec 2007 10:54

The entry "2qf9A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 05 Dec 2007 10:38

Retrieved "2qf9A01" CATHEDRAL results for job ID SID4374946484206448 and inserted them into the database.

Domain scan cathedral cath by auto on 05 Dec 2007 10:38

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 103 results for 2qf9A01

Update comment by auto on 05 Dec 2007 06:36

"2qf9A01" CATHEDRAL job SID4374946484206448 is not yet finished.

Cathedral cath submit by auto on 05 Dec 2007 06:30

The entry "2qf9A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 05 Dec 2007 06:30

The entry "2qf9A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 05 Dec 2007 03:22

Unable to insert the domain scan results from "2qf9A01" CATHEDRAL job SID5581484598210988.

Update comment by auto on 04 Dec 2007 23:01

"2qf9A01" CATHEDRAL job SID5581484598210988 is not yet finished.

Flow stage update by auto on 04 Dec 2007 22:53

The entry "2qf9A01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 04 Dec 2007 22:53

The entry "2qf9A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 04 Dec 2007 22:43

ScanList with 11650 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qf9A01.scanlist" for "2qf9A01"

Write scan list by auto on 04 Dec 2007 22:43

Writing ScanList containing 11650 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qf9A01.scanlist" for domain "2qf9A01"

Update comment by auto on 04 Dec 2007 18:15

Waiting for 43 new domains (example : 2z2eB00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 15:07

Waiting for 127 new domains (example : 2z2eB00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 10:15

Waiting for 206 new domains (example : 2vfzA00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 08:39

Waiting for 257 new domains (example : 2rb8A00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 02:36

Waiting for 335 new domains (example : 2r5qA00) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 22:42

Waiting for 410 new domains (example : 2qluA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 18:15

Waiting for 486 new domains (example : 2o2cB01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 14:51

Waiting for 559 new domains (example : 2ihuB03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 10:16

Waiting for 634 new domains (example : 2e2gJ02) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 07:39

Waiting for 665 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 02:42

Waiting for 642 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 22:33

Waiting for 633 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 18:28

Waiting for 582 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 16:54

Waiting for 555 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 10:15

Waiting for 492 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 07:10

Waiting for 574 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 22:15

Waiting for 624 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 18:53

Waiting for 698 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 14:15

Waiting for 787 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 11:43

Waiting for 869 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 06:27

Waiting for 942 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 02:30

Waiting for 1001 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 23:27

Waiting for 1059 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 18:17

Waiting for 1133 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 14:50

Waiting for 1234 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 10:39

Waiting for 1324 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 08:18

Waiting for 1411 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Nov 2007 22:10

Waiting for 1402 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Nov 2007 11:06

Waiting for 1512 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 29 Nov 2007 10:33

Moving these domains back to write scan list as we want to avoid any problems caused by the remediation that occurred whilst they were progressing through their scans.

Update comment by auto on 28 Nov 2007 22:34

PRC_PFAMCATH job SID6315693861053840 is not yet finished.

Prc pfamcath submit by auto on 28 Nov 2007 22:30

The entry "2qf9A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 28 Nov 2007 22:30

The entry "2qf9A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 28 Nov 2007 18:47

Unable to retrieve "2qf9A01" PRC_PFAMCATH results for job "SID7917654545040512"

Update comment by auto on 27 Nov 2007 22:31

PRC_PFAMCATH job SID7917654545040512 is not yet finished.

Prc pfamcath submit by auto on 27 Nov 2007 22:28

The entry "2qf9A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 27 Nov 2007 22:28

The entry "2qf9A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 27 Nov 2007 20:05

Unable to retrieve "2qf9A01" PRC_PFAMCATH results for job "SID1478398980443056"

Update comment by auto on 24 Nov 2007 14:52

PRC_PFAMCATH job SID1478398980443056 is not yet finished.

Flow stage update by auto on 24 Nov 2007 14:49

The entry "2qf9A01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 24 Nov 2007 14:49

The entry "2qf9A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 24 Nov 2007 10:59

Giving up on PRC_PFAMCATH job SID6149999384737952 because submission time of Tue Nov 20 10:35:08 2007 is more than 345600 seconds older than current time (Sat Nov 24 10:59:24 2007).

Update comment by auto on 20 Nov 2007 10:36

PRC_PFAMCATH job SID6149999384737952 is not yet finished.

Prc pfamcath submit by auto on 20 Nov 2007 10:35

The entry "2qf9A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 20 Nov 2007 10:35

The entry "2qf9A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 20 Nov 2007 10:18

Retrieved SSAP results for job ID SID8083313029189376 and results inserted.

Domain scan ssap cath by auto on 20 Nov 2007 10:16

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1402 results for 2qf9A01

Update comment by auto on 18 Nov 2007 02:22

SSAP job SID8083313029189376 is not yet finished.

Ssap cath submit by auto on 18 Nov 2007 02:18

The entry "2qf9A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 18 Nov 2007 02:18

The entry "2qf9A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 17 Nov 2007 22:17

Giving up on SSAP job SID2092855425535024 because submission time of Tue Nov 13 22:12:07 2007 is more than 345600 seconds older than current time (Sat Nov 17 22:17:12 2007).

Update comment by auto on 13 Nov 2007 22:15

SSAP job SID2092855425535024 is not yet finished.

Flow stage update by auto on 13 Nov 2007 22:12

The entry "2qf9A01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 13 Nov 2007 22:12

The entry "2qf9A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 13 Nov 2007 18:37

Unable to retrieve "2qf9A01" SSAP results for job "SID5567790007085600"

Update comment by auto on 13 Nov 2007 12:05

SSAP job SID5567790007085600 is not yet finished.

Ssap cath submit by auto on 13 Nov 2007 12:00

The entry "2qf9A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 13 Nov 2007 12:00

The entry "2qf9A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 13 Nov 2007 00:50

Unable to retrieve "2qf9A01" SSAP results for job "SID4417082404397568"

Update comment by auto on 15 Sep 2007 14:29

SSAP job SID4417082404397568 is not yet finished.

Ssap cath submit by auto on 15 Sep 2007 14:21

The entry "2qf9A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 14:21

The entry "2qf9A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 08:29

Giving up on SSAP job SID1765254790533984 because submission time of Sun Sep 9 22:54:34 2007 is more than 345600 seconds older than current time (Sat Sep 15 08:29:17 2007).

Update comment by auto on 09 Sep 2007 23:32

SSAP job SID1765254790533984 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:54

The entry "2qf9A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:54

The entry "2qf9A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:25

Giving up on SSAP job SID5468924670255830 because submission time of Wed Sep 5 19:04:39 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:25:23 2007).

Update comment by auto on 05 Sep 2007 20:08

SSAP job SID5468924670255830 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 19:04

The entry "2qf9A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 19:04

The entry "2qf9A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 14:56

Retrieved PRC results for job ID SID8068500836462784 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 14:55

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2qf9A01

Prc cath submit by auto on 05 Sep 2007 04:41

The entry "2qf9A01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 04:41

The entry "2qf9A01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 02:34

Retrieved HMM(SAM) results for job ID SID1105559136534223 and inserted them into the database.

Domain scan sam cath by auto on 05 Sep 2007 02:33

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2qf9A01

Update comment by auto on 04 Sep 2007 13:33

HMM(SAM) job SID1105559136534223 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:40

The entry "2qf9A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:40

The entry "2qf9A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 08:39

Retrieved "2qf9A01" CATHEDRAL results for job ID SID4677292281077280 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 08:38

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 102 results for 2qf9A01

Cathedral cath submit by auto on 03 Sep 2007 14:40

The entry "2qf9A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:40

The entry "2qf9A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:59

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qf9A01.scanlist" for "2qf9A01"

Write scan list by auto on 03 Sep 2007 12:59

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qf9A01.scanlist" for domain "2qf9A01"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:33

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:33

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:23

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:23

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:17

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:30

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 02 Sep 2007 02:24

No satisfactory AssignClose result found.

Flow stage update by auto on 02 Sep 2007 02:10

No in_process hits for Domain "2qf9A01" ready to be processed

Flow stage update by auto on 02 Sep 2007 02:10

NW result present for Domain "2qf9A01"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2qf9A01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2qf9A01"

Insertion by cuff on 23 Aug 2007 14:44

nice chopping