CATH Domain: 2qf3B02 XML data for domain: 2qf3B02

Molscript image for 2qf3B02
2qf3B02
PDB coordinates for domain 2qf3B02

PDB 2qf3, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.40 Beta Barrel
2.40.10 Thrombin, subunit H
2.40.10.10 Trypsin-like serine proteases Gene3D
2.40.10.10.67
2.40.10.10.67.1
2.40.10.10.67.1.1
2.40.10.10.67.1.1.1
2.40.10.10.67.1.1.1.1

[top]
Segment boundaries for domain 2qf3B02

Chopping figure for domain 2qf3B02
DomainStart PDB ResidueStop PDB Residue
2qf3B01 38 141
2qf3B02 142 251

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 2.40.10.10.67.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1lcyA02 86.01 Serine-type endopeptidase activityHtrA serine peptidase 2 [EC:3.4.21.108]Endoplasmic reticulum membraneParkinson's diseaseNucleus 2.40.10.10 84 44 80 2.78 3.45
2o8mA02 82.23 Genome polyproteinHepatitis C virus subtype 1a 2.40.10.10 87 10 75 2.64 3.49
2hrvA02 80.81 Genome polyproteinHuman rhinovirus 2 2.40.10.10 95 11 80 3.01 3.74
1si5H01 80.57 Pathways in cancerHepatocyte growth factorEpithelial to mesenchymal transitionRenal cell carcinomaCytokine-cytokine receptor interaction 2.40.10.10 119 11 74 3.04 4.06
1befA02 78.04 2.40.10.10 85 8 66 2.37 3.54
1q3xA02 77.91 Serine-type endopeptidase activityHomo sapiensMannan-binding lectin serine protease 2Calcium-dependent protein bindingComplement activation, lectin pathway 2.40.10.10 137 15 67 2.86 4.26
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qf3B02
PINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFT
PEGIGFAIPFQLATKIMDKLIRD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qf3B02
PINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFD
KSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIR
BLAST against CATH

[top]
Domain History Events (25)

Domain assigned by auto on 05 Aug 2008 22:05

Assigning to "2.40.10.10" based on similarity with "2qf3C02"

Flow stage update by auto on 05 Aug 2008 22:05

No in_process hits for Domain "2qf3B02" ready to be processed

Update comment by auto on 05 Aug 2008 22:02

Domain "2qf3B02" hits Domain "2qf3C02" (100% over 100%) which is currently in process

Update comment by auto on 05 Aug 2008 21:53

Domain "2qf3B02" hits Domain "2qf0I02" (98.2608695652174% over 100%) which is currently in process

Update comment by auto on 05 Aug 2008 21:50

Domain "2qf3B02" hits Domain "2qf0H02" (98.2608695652174% over 100%) which is currently in process

Update comment by auto on 05 Aug 2008 21:48

Domain "2qf3B02" hits Domain "2qf0G02" (98.2608695652174% over 100%) which is currently in process

Update comment by auto on 05 Aug 2008 21:44

Domain "2qf3B02" hits Domain "2qf0F02" (98.2608695652174% over 100%) which is currently in process

Update comment by auto on 05 Aug 2008 21:34

Domain "2qf3B02" hits Domain "2qf0E02" (98.2608695652174% over 100%) which is currently in process

Update comment by auto on 05 Aug 2008 21:31

Domain "2qf3B02" hits Domain "2qf0D02" (98.2608695652174% over 100%) which is currently in process

Update comment by auto on 05 Aug 2008 21:29

Domain "2qf3B02" hits Domain "2qf0C02" (98.2608695652174% over 100%) which is currently in process

Update comment by auto on 05 Aug 2008 21:26

Domain "2qf3B02" hits Domain "2qf0B02" (98.2608695652174% over 100%) which is currently in process

Update comment by auto on 05 Aug 2008 21:24

Domain "2qf3B02" hits Domain "2rceI02" (99.1304347826087% over 100%) which is currently in process

Update comment by auto on 05 Aug 2008 21:22

Domain "2qf3B02" hits Domain "2rceG02" (99.1304347826087% over 100%) which is currently in process

Update comment by auto on 05 Aug 2008 21:15

Domain "2qf3B02" hits Domain "2rceF02" (99.1304347826087% over 100%) which is currently in process

Update comment by auto on 05 Aug 2008 21:12

Domain "2qf3B02" hits Domain "2rceD02" (99.1304347826087% over 100%) which is currently in process

Update comment by auto on 05 Aug 2008 21:09

Domain "2qf3B02" hits Domain "2rceC02" (99.1304347826087% over 100%) which is currently in process

Update comment by auto on 05 Aug 2008 21:06

Domain "2qf3B02" hits Domain "2rceB02" (99.1304347826087% over 100%) which is currently in process

Update comment by auto on 05 Aug 2008 21:01

Domain "2qf3B02" hits Domain "2rceA02" (99.1304347826087% over 100%) which is currently in process

Update comment by auto on 05 Aug 2008 20:50

Domain "2qf3B02" hits Domain "2rceH02" (99.1304347826087% over 100%) which is currently in process

Update comment by auto on 05 Aug 2008 20:33

Domain "2qf3B02" hits Domain "2rceE02" (99.1304347826087% over 100%) which is currently in process

Flow stage update by auto on 05 Aug 2008 20:13

Domain "2qf3B02" hits Domain "2rceE02" (99.1304347826087% over 100%) which is currently in process

Flow stage update by auto on 05 Aug 2008 20:13

NW result present for Domain "2qf3B02"

Flow stage update by auto on 05 Aug 2008 11:17

All required files are present for Domain "2qf3B02"

Flow stage update by auto on 04 Aug 2008 19:17

Beginning processing for Domain "2qf3B02"

Insertion by auto on 04 Aug 2008 18:07

Final ChopClose added based on similarity with "2rceA"