Domain assigned by auto on 05 Aug 2008 22:05
Assigning to "2.40.10.10" based on similarity with "2qf3C02"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2qf3B01 | 38 | 141 |
| 2qf3B02 | 142 | 251 |
There are 6 matching structural neighberhood comparisons for CATH ID 2.40.10.10.67.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1lcyA02 | 86.01 | 2.40.10.10 | 84 | 44 | 80 | 2.78 | 3.45 | |
![]() |
2o8mA02 | 82.23 | 2.40.10.10 | 87 | 10 | 75 | 2.64 | 3.49 | |
![]() |
2hrvA02 | 80.81 | 2.40.10.10 | 95 | 11 | 80 | 3.01 | 3.74 | |
![]() |
1si5H01 | 80.57 | 2.40.10.10 | 119 | 11 | 74 | 3.04 | 4.06 | |
![]() |
1befA02 | 78.04 | 2.40.10.10 | 85 | 8 | 66 | 2.37 | 3.54 | |
![]() |
1q3xA02 | 77.91 | 2.40.10.10 | 137 | 15 | 67 | 2.86 | 4.26 |
>pdb|2qf3B02 PINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFT PEGIGFAIPFQLATKIMDKLIRD
Assigning to "2.40.10.10" based on similarity with "2qf3C02"
No in_process hits for Domain "2qf3B02" ready to be processed
Domain "2qf3B02" hits Domain "2qf3C02" (100% over 100%) which is currently in process
Domain "2qf3B02" hits Domain "2qf0I02" (98.2608695652174% over 100%) which is currently in process
Domain "2qf3B02" hits Domain "2qf0H02" (98.2608695652174% over 100%) which is currently in process
Domain "2qf3B02" hits Domain "2qf0G02" (98.2608695652174% over 100%) which is currently in process
Domain "2qf3B02" hits Domain "2qf0F02" (98.2608695652174% over 100%) which is currently in process
Domain "2qf3B02" hits Domain "2qf0E02" (98.2608695652174% over 100%) which is currently in process
Domain "2qf3B02" hits Domain "2qf0D02" (98.2608695652174% over 100%) which is currently in process
Domain "2qf3B02" hits Domain "2qf0C02" (98.2608695652174% over 100%) which is currently in process
Domain "2qf3B02" hits Domain "2qf0B02" (98.2608695652174% over 100%) which is currently in process
Domain "2qf3B02" hits Domain "2rceI02" (99.1304347826087% over 100%) which is currently in process
Domain "2qf3B02" hits Domain "2rceG02" (99.1304347826087% over 100%) which is currently in process
Domain "2qf3B02" hits Domain "2rceF02" (99.1304347826087% over 100%) which is currently in process
Domain "2qf3B02" hits Domain "2rceD02" (99.1304347826087% over 100%) which is currently in process
Domain "2qf3B02" hits Domain "2rceC02" (99.1304347826087% over 100%) which is currently in process
Domain "2qf3B02" hits Domain "2rceB02" (99.1304347826087% over 100%) which is currently in process
Domain "2qf3B02" hits Domain "2rceA02" (99.1304347826087% over 100%) which is currently in process
Domain "2qf3B02" hits Domain "2rceH02" (99.1304347826087% over 100%) which is currently in process
Domain "2qf3B02" hits Domain "2rceE02" (99.1304347826087% over 100%) which is currently in process
Domain "2qf3B02" hits Domain "2rceE02" (99.1304347826087% over 100%) which is currently in process
NW result present for Domain "2qf3B02"
All required files are present for Domain "2qf3B02"
Beginning processing for Domain "2qf3B02"
Final ChopClose added based on similarity with "2rceA"