CATH Domain: 2qeuB00 XML data for domain: 2qeuB00

Molscript image for 2qeuB00
2qeuB00
PDB coordinates for domain 2qeuB00

PDB 2qeu, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1290 AhpD-like
1.20.1290.10 AhpD-like Gene3D
1.20.1290.10.3
1.20.1290.10.3.1
1.20.1290.10.3.1.1
1.20.1290.10.3.1.1.1
1.20.1290.10.3.1.1.1.1

[top]
Segment boundaries for domain 2qeuB00

Chopping figure for domain 2qeuB00
DomainStart PDB ResidueStop PDB Residue
2qeuB00 8 140

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.20.1290.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1vkeB00 83.41 Thermotoga maritimaPutative uncharacterized protein 1.20.1290.10 101 19 74 2.18 2.94
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qeuB00
TSQDILKQHAAHYESDGGLPEALVQLAEYAPETFDAYSRRTTLKSEADGAKLPLKYKHLILVVLDAIRDEPIGIVNHTRA
ANAGLSVDELIEGILLGIIVYGPAWGKTGRKAVTFAVEFEKELAGKRT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qeuB00
GXDQESNATSQDILKQHAAHYESDXGGLPEALVQLAEYAPETFDAYSRXRTTXLKSEADGAKLPLKYKHLILVVLDAIRD
EPIGIVNHTRAAXNAGLSVDELIEGILLGIIVYGXPAWGKTGRKAVTFAVEFEKELAGKRT
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 18 Feb 2008 14:30

Assigning to "1.20.1290.10" based on similarity with "2qeuC00"

Flow stage update by auto on 18 Feb 2008 14:13

No in_process hits for Domain "2qeuB00" ready to be processed

Update comment by auto on 18 Feb 2008 13:59

Domain "2qeuB00" hits Domain "2qeuC00" (95.7446808510638% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "2qeuB00" hits Domain "2qeuA00" (95.7446808510638% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2qeuB00" hits Domain "2qeuA00" (95.7446808510638% over 100%) which is currently in process

Update comment by auto on 01 Sep 2007 22:04

Domain "2qeuB00" hits Domain "2qeuA00" (95.7446808510638% over 100%) which is currently in process

Flow stage update by auto on 01 Sep 2007 22:03

Domain "2qeuB00" hits Domain "2qeuA00" (95.7446808510638% over 100%) which is currently in process

Flow stage update by auto on 01 Sep 2007 22:03

NW result present for Domain "2qeuB00"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2qeuB00"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2qeuB00"

Insertion by auto on 23 Aug 2007 15:09

Final ChopClose added based on similarity with "2qeuA"