CATH Domain: 2qe8A00 XML data for domain: 2qe8A00

Molscript image for 2qe8A00
2qe8A00
PDB coordinates for domain 2qe8A00

PDB 2qe8, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.120 6 Propellor
2.120.10 Neuraminidase
2.120.10.30 TolB, C-terminal domain Gene3D
2.120.10.30.2
2.120.10.30.2.1
2.120.10.30.2.1.1
2.120.10.30.2.1.1.1
2.120.10.30.2.1.1.1.1

[top]
Segment boundaries for domain 2qe8A00

Chopping figure for domain 2qe8A00
DomainStart PDB ResidueStop PDB Residue
2qe8A00 6 342

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 2.120.10.30.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2p4oA01 78.41 Nostoc sp. PCC 7120All0351 protein 2.120.10.30 285 16 81 3.71 4.56
1rwiA00 77.64 Serine/threonine protein kinase, bacterial [EC:2.7.11.1]Serine/threonine-protein kinase pknDMycobacterium tuberculosis 2.120.10.30 256 15 74 3.32 4.43
1npeA00 76.49 Mus musculusCell-matrix adhesionNidogen-1Collagen bindingBasement membrane 2.120.10.30 263 8 69 3.02 4.33
1ijqA01 75.64 Low-density lipoprotein particle clearanceIntestinal cholesterol absorptionVery-low-density lipoprotein receptor activityProtein O-linked glycosylationLow-density lipoprotein receptor 2.120.10.30 254 14 68 3.30 4.84
2ghsA00 75.51 Calcium-binding protein, regucalcinAgrobacterium tumefaciens str. C58 2.120.10.30 282 13 78 3.63 4.62
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qe8A00
DRLEVVAELSLAPGNITLTPDGRLFLSLHQFYQPEQVAELTQDGLIPFPPQSGNAIITFDTVLGIKSDGNGIVWLDNGNQ
SKSVPKLVAWDTLNNQLSRVIYLPPPITLSNSFVNDLAVDLIHNFVYISDPAPDDKAALIRVDLQTGLAARVLQGYPGIA
PEDIDLVIDGVPVQIGQPDGTVIRPHLGVNGIVLDAENEWLYLSPHSTSYRIKSADLSNLQLTDAELGSKIERYSEKPIC
DGISIDKDHNIYVGDLAHSAIGVITSADRAYKLLVTDEKLSWTDSFNFGSDGYLYFDCNQLHHSAPLNAGENISAPPYYI
FRLKPLAAGIVGR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qe8A00
GXENLGDRLEVVAELSLAPGNITLTPDGRLFLSLHQFYQPEXQVAELTQDGLIPFPPQSGNAIITFDTVLGIKSDGNGIV
WXLDNGNQSKSVPKLVAWDTLNNQLSRVIYLPPPITLSNSFVNDLAVDLIHNFVYISDPAPDDKAALIRVDLQTGLAARV
LQGYPGIAPEDIDLVIDGVPVQIGQPDGTVIRPHLGVNGIVLDAENEWLYLSPXHSTSXYRIKSADLSNLQLTDAELGSK
IERYSEKPICDGISIDKDHNIYVGDLAHSAIGVITSADRAYKLLVTDEKLSWTDSFNFGSDGYLYFDCNQLHHSAPLNAG
ENISAPPYYIFRLKPLAAGIVGR
BLAST against CATH

[top]
Domain History Events (135)

Domain assigned by cuff on 07 Mar 2008 17:43

same superfamily

Domain assignment manual match h by tronnberg on 10 Dec 2007 12:00

SSAP: 78.1 OV: 80 SEQ: 11. The query's function is unknnown. Although the seq sim is not high enough I believe that this two can be assigned into the same homology family.

Homcheck review by tronnberg on 10 Dec 2007 12:00

SSAP: 78.1 OV: 80 SEQ: 11. The query's function is unknnown. Although the seq sim is not high enough I believe that this two can be assigned into the same homology family.

Flow stage update by tronnberg on 10 Dec 2007 12:00

SSAP: 78.1 OV: 80 SEQ: 11. The query's function is unknnown. Although the seq sim is not high enough I believe that this two can be assigned into the same homology family.

Homcheck allotment by tronnberg on 10 Dec 2007 11:57

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 10 Dec 2007 11:57

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 09 Dec 2007 14:59

Domain "2qe8A00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 09 Dec 2007 14:59

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qe8A00

Flow stage update by auto on 08 Dec 2007 18:52

Retrieved PRC_PFAMCATH results for job ID SID7586544992985152 and results inserted.

Domain scan prc pfamcath by auto on 08 Dec 2007 18:52

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 111 results for 2qe8A00

Update comment by auto on 08 Dec 2007 06:56

PRC_PFAMCATH job SID7586544992985152 is not yet finished.

Prc pfamcath submit by auto on 08 Dec 2007 06:54

The entry "2qe8A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Dec 2007 06:54

The entry "2qe8A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Dec 2007 06:40

Retrieved SSAP results for job ID SID5530549530960640 and results inserted.

Domain scan ssap cath by auto on 08 Dec 2007 06:39

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 79 results for 2qe8A00

Update comment by auto on 05 Dec 2007 19:07

SSAP job SID5530549530960640 is not yet finished.

Ssap cath submit by auto on 05 Dec 2007 19:01

The entry "2qe8A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Dec 2007 19:01

The entry "2qe8A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Dec 2007 18:48

Retrieved PRC results for job ID SID4645663092761504 and inserted them into the database.

Domain scan prc cath by auto on 05 Dec 2007 18:48

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 21 results for 2qe8A00

Update comment by auto on 05 Dec 2007 15:04

PRC job SID4645663092761504 is not yet finished.

Prc cath submit by auto on 05 Dec 2007 14:57

The entry "2qe8A00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Dec 2007 14:57

The entry "2qe8A00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Dec 2007 14:45

Retrieved HMM(SAM) results for job ID SID8739799929663648 and inserted them into the database.

Domain scan sam cath by auto on 05 Dec 2007 14:45

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 9 results for 2qe8A00

Update comment by auto on 05 Dec 2007 10:59

HMM(SAM) job SID8739799929663648 is not yet finished.

Flow stage update by auto on 05 Dec 2007 10:54

The entry "2qe8A00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 05 Dec 2007 10:54

The entry "2qe8A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 05 Dec 2007 10:37

Retrieved "2qe8A00" CATHEDRAL results for job ID SID1471553658433888 and inserted them into the database.

Domain scan cathedral cath by auto on 05 Dec 2007 10:37

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 49 results for 2qe8A00

Update comment by auto on 05 Dec 2007 06:36

"2qe8A00" CATHEDRAL job SID1471553658433888 is not yet finished.

Flow stage update by auto on 05 Dec 2007 06:30

The entry "2qe8A00" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 05 Dec 2007 06:30

The entry "2qe8A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 05 Dec 2007 03:21

Unable to insert the domain scan results from "2qe8A00" CATHEDRAL job SID0921758441900682.

Update comment by auto on 04 Dec 2007 23:01

"2qe8A00" CATHEDRAL job SID0921758441900682 is not yet finished.

Cathedral cath submit by auto on 04 Dec 2007 22:52

The entry "2qe8A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 04 Dec 2007 22:52

The entry "2qe8A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 04 Dec 2007 22:42

ScanList with 11650 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qe8A00.scanlist" for "2qe8A00"

Write scan list by auto on 04 Dec 2007 22:42

Writing ScanList containing 11650 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qe8A00.scanlist" for domain "2qe8A00"

Update comment by auto on 04 Dec 2007 18:15

Waiting for 43 new domains (example : 2z2eB00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 15:07

Waiting for 127 new domains (example : 2z2eB00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 10:15

Waiting for 206 new domains (example : 2vfzA00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 08:39

Waiting for 257 new domains (example : 2rb8A00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 02:36

Waiting for 335 new domains (example : 2r5qA00) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 22:42

Waiting for 410 new domains (example : 2qluA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 18:15

Waiting for 486 new domains (example : 2o2cB01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 14:51

Waiting for 559 new domains (example : 2ihuB03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 10:16

Waiting for 634 new domains (example : 2e2gJ02) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 07:39

Waiting for 665 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 02:42

Waiting for 642 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 22:33

Waiting for 633 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 18:28

Waiting for 582 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 16:54

Waiting for 555 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 10:15

Waiting for 492 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 07:10

Waiting for 574 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 22:15

Waiting for 624 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 18:53

Waiting for 698 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 14:15

Waiting for 787 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 11:43

Waiting for 869 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 06:27

Waiting for 942 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 02:30

Waiting for 1001 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 23:27

Waiting for 1059 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 18:17

Waiting for 1133 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 14:50

Waiting for 1234 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 10:39

Waiting for 1324 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 08:17

Waiting for 1411 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Nov 2007 22:10

Waiting for 1402 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Nov 2007 11:06

Waiting for 1512 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 29 Nov 2007 10:33

Moving these domains back to write scan list as we want to avoid any problems caused by the remediation that occurred whilst they were progressing through their scans.

Update comment by auto on 28 Nov 2007 22:34

PRC_PFAMCATH job SID5191688258643312 is not yet finished.

Prc pfamcath submit by auto on 28 Nov 2007 22:30

The entry "2qe8A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 28 Nov 2007 22:30

The entry "2qe8A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 28 Nov 2007 18:47

Unable to retrieve "2qe8A00" PRC_PFAMCATH results for job "SID4540101320652672"

Update comment by auto on 26 Nov 2007 10:55

PRC_PFAMCATH job SID4540101320652672 is not yet finished.

Flow stage update by auto on 26 Nov 2007 10:53

The entry "2qe8A00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 26 Nov 2007 10:53

The entry "2qe8A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 26 Nov 2007 06:44

Giving up on PRC_PFAMCATH job SID0638551739274694 because submission time of Thu Nov 22 06:16:27 2007 is more than 345600 seconds older than current time (Mon Nov 26 06:45:02 2007).

Update comment by auto on 22 Nov 2007 06:18

PRC_PFAMCATH job SID0638551739274694 is not yet finished.

Flow stage update by auto on 22 Nov 2007 06:16

The entry "2qe8A00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 22 Nov 2007 06:16

The entry "2qe8A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 22 Nov 2007 06:16

Retrieved SSAP results for job ID SID5033344826532200 and results inserted.

Domain scan ssap cath by auto on 22 Nov 2007 06:16

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 74 results for 2qe8A00

Update comment by auto on 18 Nov 2007 10:18

SSAP job SID5033344826532200 is not yet finished.

Ssap cath submit by auto on 18 Nov 2007 10:16

The entry "2qe8A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 18 Nov 2007 10:16

The entry "2qe8A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 18 Nov 2007 06:17

Giving up on SSAP job SID4801782949942912 because submission time of Wed Nov 14 06:14:07 2007 is more than 345600 seconds older than current time (Sun Nov 18 06:17:26 2007).

Update comment by auto on 14 Nov 2007 06:15

SSAP job SID4801782949942912 is not yet finished.

Flow stage update by auto on 14 Nov 2007 06:14

The entry "2qe8A00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 14 Nov 2007 06:14

The entry "2qe8A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Nov 2007 02:26

Unable to retrieve "2qe8A00" SSAP results for job "SID5823342467385248"

Update comment by auto on 13 Nov 2007 12:04

SSAP job SID5823342467385248 is not yet finished.

Ssap cath submit by auto on 13 Nov 2007 12:00

The entry "2qe8A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 13 Nov 2007 12:00

The entry "2qe8A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 13 Nov 2007 00:49

Unable to retrieve "2qe8A00" SSAP results for job "SID0475069449754720"

Update comment by auto on 15 Sep 2007 14:29

SSAP job SID0475069449754720 is not yet finished.

Flow stage update by auto on 15 Sep 2007 14:20

The entry "2qe8A00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 15 Sep 2007 14:20

The entry "2qe8A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 08:28

Giving up on SSAP job SID2157545657700716 because submission time of Sun Sep 9 22:53:34 2007 is more than 345600 seconds older than current time (Sat Sep 15 08:28:31 2007).

Update comment by auto on 09 Sep 2007 23:31

SSAP job SID2157545657700716 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:53

The entry "2qe8A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:53

The entry "2qe8A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:24

Giving up on SSAP job SID1290185314849576 because submission time of Wed Sep 5 19:03:41 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:24:24 2007).

Update comment by auto on 05 Sep 2007 20:07

SSAP job SID1290185314849576 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 19:03

The entry "2qe8A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 19:03

The entry "2qe8A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 14:47

Retrieved PRC results for job ID SID7171406400743360 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 14:46

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 19 results for 2qe8A00

Prc cath submit by auto on 05 Sep 2007 04:40

The entry "2qe8A00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 04:40

The entry "2qe8A00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 02:26

Retrieved HMM(SAM) results for job ID SID5239812119951629 and inserted them into the database.

Domain scan sam cath by auto on 05 Sep 2007 02:25

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 10 results for 2qe8A00

Update comment by auto on 04 Sep 2007 13:32

HMM(SAM) job SID5239812119951629 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:39

The entry "2qe8A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:39

The entry "2qe8A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 08:29

Retrieved "2qe8A00" CATHEDRAL results for job ID SID4840606686842987 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 08:28

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 49 results for 2qe8A00

Cathedral cath submit by auto on 03 Sep 2007 14:39

The entry "2qe8A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:39

The entry "2qe8A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:58

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qe8A00.scanlist" for "2qe8A00"

Write scan list by auto on 03 Sep 2007 12:58

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qe8A00.scanlist" for domain "2qe8A00"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:33

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:33

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:23

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:23

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:29

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:14

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Sep 2007 22:10

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Sep 2007 22:03

No in_process hits for Domain "2qe8A00" ready to be processed

Flow stage update by auto on 01 Sep 2007 22:03

NW result present for Domain "2qe8A00"

Flow stage update by auto on 29 Aug 2007 14:34

All required files are present for Domain "2qe8A00"

Flow stage update by auto on 28 Aug 2007 18:20

Beginning processing for Domain "2qe8A00"

Insertion by cuff on 28 Aug 2007 16:32

nice chopping