Domain assigned by auto on 29 Nov 2007 02:34
Assigning to "2.40.30.10" based on similarity with "1a8pA01"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2qdxA01 | 2 | 96 |
| 2qdxA02 | 97 | 258 |
There are 16 matching structural neighberhood comparisons for CATH ID 2.40.30.10.10.1.1.1.1 (SIMAX score < 5)
>pdb|2qdxA01 SNLYTERVLSVHHWNDTLFSFKTTRNPGLRFKTGQFVMIGLEVDGRPLMRAYSIASPNYEEHLEFFSIKVPDGPLTSRLQ HLKEGDELMVSRKPT
Assigning to "2.40.30.10" based on similarity with "1a8pA01"
No in_process hits for Domain "2qdxA01" ready to be processed
NW result present for Domain "2qdxA01"
All required files are present for Domain "2qdxA01"
Beginning processing for Domain "2qdxA01"
Final ChopClose added based on similarity with "1a8pA"