CATH Domain: 2qcxA00 XML data for domain: 2qcxA00

Molscript image for 2qcxA00
2qcxA00
PDB coordinates for domain 2qcxA00

PDB 2qcx, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.910 Heme Oxygenase; Chain A
1.20.910.10 Heme Oxygenase; Chain A Gene3D
1.20.910.10.13
1.20.910.10.13.1
1.20.910.10.13.1.1
1.20.910.10.13.1.1.1
1.20.910.10.13.1.1.1.1

[top]
Segment boundaries for domain 2qcxA00

Chopping figure for domain 2qcxA00
DomainStart PDB ResidueStop PDB Residue
2qcxA00 -1 220

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.20.910.10.13.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1rtwB00 88.57 Pyrococcus furiosusTranscriptional activator, putative 1.20.910.10 204 22 91 1.83 1.99
1rcwB00 83.15 Chlamydia trachomatisPqqC-like proteinPyrroloquinoline-quinone synthase [EC:1.3.3.11] 1.20.910.10 210 14 90 3.05 3.35
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qcxA00
QGMKFSEECRSAAAEWWEGSFVHPFVQGIGDGTLPIDRFKYYVLQDSYYLTHFAKVQSFGAAYAKDLYTTGRMASHAQGT
YEAEMALHREFAELLEISEEERKAFKPSPTAYSFTSHMYRSVLSGNFAEILAALLPCYWLYYEVGEKLLHCDPGHPIYQK
WIGTYGGDWFRQQVEEQINRFDELAENSTEEVRAKMKENFVISSYYEYQFWGMAYRKEGWSD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qcxA00
QGMKFSEECRSAAAEWWEGSFVHPFVQGIGDGTLPIDRFKYYVLQDSYYLTHFAKVQSFGAAYAKDLYTTGRMASHAQGT
YEAEMALHREFAELLEISEEERKAFKPSPTAYSFTSHMYRSVLSGNFAEILAALLPCYWLYYEVGEKLLHCDPGHPIYQK
WIGTYGGDWFRQQVEEQINRFDELAENSTEEVRAKMKENFVISSYYEYQFWGMAYRKEGWSD
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 28 Nov 2007 22:27

Assigning to "1.20.910.10" based on similarity with "1yakA00"

Flow stage update by auto on 28 Nov 2007 22:13

No in_process hits for Domain "2qcxA00" ready to be processed

Flow stage update by auto on 28 Nov 2007 22:13

NW result present for Domain "2qcxA00"

Flow stage update by auto on 24 Nov 2007 14:38

All required files are present for Domain "2qcxA00"

Flow stage update by auto on 23 Nov 2007 14:01

Beginning processing for Domain "2qcxA00"

Insertion by auto on 23 Nov 2007 11:34

Final ChopClose added based on similarity with "1yafA"