CATH Domain: 2qcvA01

2qcvA01

PDB 2qcv, Chain A, Domain 1

CATH Code	Level Description	Links
3	Alpha Beta
3.40	3-Layer(aba) Sandwich
3.40.1190	UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase
3.40.1190.20		Gene3D
3.40.1190.20.12
3.40.1190.20.12.1
3.40.1190.20.12.1.1
3.40.1190.20.12.1.1.1
3.40.1190.20.12.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2qcvA01

Domain	Start PDB Residue	Stop PDB Residue
2qcvA01	10	18
2qcvA01	45	97
2qcvA01	116	331
2qcvA02	19	44
2qcvA02	98	114

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.40.1190.20.12.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
1v1aA00	84.76	Thermus thermophilus HB82-dehydro-3-deoxygluconokinase [EC:2.7.1.45]Pentose and glucuronate interconversionsPentose phosphate pathway2-keto-3-deoxy-gluconate kinase	3.40.1190.20	301	25	81	2.02	2.49
1tyyB00	84.67	Amino sugar and nucleotide sugar metabolismStarch and sucrose metabolismFructose and mannose metabolismMetabolic pathwaysFructokinase [EC:2.7.1.4]	3.40.1190.20	292	22	83	2.33	2.78
2afbB00	82.93	Thermotoga maritima2-dehydro-3-deoxygluconokinase [EC:2.7.1.45]Pentose phosphate pathwayPentose and glucuronate interconversions2-keto-3-deoxygluconate kinase	3.40.1190.20	319	20	77	2.20	2.85
2fv7A00	82.73	Pentose phosphate pathwayRibokinaseRibokinase [EC:2.7.1.15]Homo sapiens	3.40.1190.20	308	19	77	2.54	3.26
2ajrA01	81.14	Thermotoga maritima1-phosphofructokinase [EC:2.7.1.56]Fructose and mannose metabolismSugar kinase, pfkB family	3.40.1190.20	259	16	88	3.23	3.65
2abqA00	80.56	Fructose 1-phosphate kinase1-phosphofructokinase [EC:2.7.1.56]Fructose and mannose metabolismBacillus halodurans	3.40.1190.20	302	14	78	3.31	4.22
3bf5A01	78.91	Pentose phosphate pathwayRibokinase [EC:2.7.1.15]Thermoplasma acidophilumRibokinase related protein	3.40.1190.20	221	15	79	3.57	4.48

[top]
Domain ATOM Sequence

>pdb|2qcvA01
EFDLIAIGRSPANIVIGSSKLGLKAGFIGKIADDQHGRFIESYRGVGVDTSNLVVDQEGHKYRQDVADLYLSPEEVNEAY
IRRSKLLLVSGTALSKSPSREAVLKAIRLAKRNDVKVVFELDYRPYSWETPEETAVYYSLVAEQSDIVIGTREEFDVLEN
RTEKGDNDETIRYLFKHSPELIVIKHGVEGSFAYTKAGEAYRGYAYKTKVLKTFGAGDSYASAFLYALISGKGIETALKY
GSASASIVVSKAPSVEEIEALIEKDETITIA

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2qcvA01
EFDLIAIGRSPANIVIGSSKLGLKAGFIGKIADDQHGRFIESYXRGVGVDTSNLVVDQEGHKYRQDVADLYLSPEEVNEA
YIRRSKLLLVSGTALSKSPSREAVLKAIRLAKRNDVKVVFELDYRPYSWETPEETAVYYSLVAEQSDIVIGTREEFDVLE
NRTEKGDNDETIRYLFKHSPELIVIKHGVEGSFAYTKAGEAYRGYAYKTKVLKTFGAGDSYASAFLYALISGKGIETALK
YGSASASIVVSKHSSSDAXPSVEEIEALIEKDETITIA

BLAST against CATH

[top]
Domain History Events (73)

Domain assigned by cuff on 06 Jan 2009 13:33

same superfamily

Domain assignment manual match h by cuff on 06 Jan 2009 13:32

homology match

Homcheck allotment by cuff on 06 Jan 2009 13:30

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 06 Jan 2009 13:30

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 16 Oct 2008 00:19

Domain "2qcvA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 16 Oct 2008 00:18

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qcvA01

Flow stage update by auto on 16 Oct 2008 00:15

Retrieved PRC_PFAMCATH results for job ID SID0743424320244544 and results inserted.

Domain scan prc pfamcath by auto on 16 Oct 2008 00:15

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 79 results for 2qcvA01

Update comment by auto on 15 Oct 2008 11:56

PRC_PFAMCATH job SID0743424320244544 is not yet finished.

Flow stage update by auto on 15 Oct 2008 11:55

The entry "2qcvA01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 15 Oct 2008 11:55

The entry "2qcvA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Oct 2008 11:35

Retrieved SSAP results for job ID SID9999045242205256 and results inserted.

Domain scan ssap cath by auto on 15 Oct 2008 11:32

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1047 results for 2qcvA01

Update comment by auto on 10 Oct 2008 03:24

SSAP job SID9999045242205256 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 02:43

The entry "2qcvA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 02:43

The entry "2qcvA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Oct 2008 23:44

Retrieved PRC results for job ID SID2016123622257800 and inserted them into the database.

Domain scan prc cath by auto on 09 Oct 2008 23:44

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 21 results for 2qcvA01

Update comment by auto on 08 Oct 2008 15:20

PRC job SID2016123622257800 is not yet finished.

Prc cath submit by auto on 08 Oct 2008 15:09

The entry "2qcvA01" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 15:09

The entry "2qcvA01" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 14:36

Retrieved HMM(SAM) results for job ID SID4105553995181568 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 14:35

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 18 results for 2qcvA01