CATH Domain: 2qahA00 XML data for domain: 2qahA00

Molscript image for 2qahA00
2qahA00
PDB coordinates for domain 2qahA00

PDB 2qah, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.20 Alpha-Beta Barrel
3.20.20 TIM Barrel
3.20.20.140 Metal-dependent hydrolases Gene3D
3.20.20.140.20
3.20.20.140.20.1
3.20.20.140.20.1.1
3.20.20.140.20.1.1.1
3.20.20.140.20.1.1.1.1

[top]
Segment boundaries for domain 2qahA00

Chopping figure for domain 2qahA00
DomainStart PDB ResidueStop PDB Residue
2qahA00 3 296

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.20.20.140.20.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ffiA00 82.85 Pseudomonas putida KT24402-pyrone-4,6-dicarboxylic acid hydrolase, putative 3.20.20.140 268 27 90 3.01 3.34
3cjpA00 78.28 Predicted amidohodrolase (Dihydroorotase family)Clostridium acetobutylicum 3.20.20.140 260 13 72 2.66 3.67
2f6kA00 76.66 Metal-dependent hydrolase (Putative)Lactobacillus plantarum 3.20.20.140 300 10 79 3.63 4.58
1zzmA00 74.85 Uncharacterized deoxyribonuclease yjjVTatD DNase family protein [EC:3.1.21.-]Escherichia coli K-12 3.20.20.140 259 9 76 3.17 4.14
1j6oA00 74.34 Thermotoga maritimaTatD DNase family protein [EC:3.1.21.-]Putative uncharacterized protein 3.20.20.140 259 11 78 3.79 4.84
2ogjA02 73.13 Pyrimidine metabolismAgrobacterium tumefaciens str. C58Dihydroorotase [EC:3.5.2.3]Metabolic pathwaysPutative uncharacterized protein 3.20.20.140 256 10 78 3.91 4.95
2icsA02 73.13 Pyrimidine metabolismDihydroorotase [EC:3.5.2.3]Metabolic pathwaysEnterococcus faecalisPutative uncharacterized protein 3.20.20.140 260 9 80 3.91 4.87
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2qahA00
LTNDERILSWNETPSKPRYTPPPGAIDAHCHVFGPMAQFPFSPKAKYLPRDAGPDMLFALRDHLGFARNVIVQASCHGTD
NAATLDAIARAQGKARGIAVVDPAIDEAELAALHEGGMRGIRFNFLKRLVDDAPKDKFLEVAGRLPAGWHVVIYFEADIL
EELRPFMDAIPVPIVIDHMGRPDVRQGPDGADMKAFRRLLDSREDIWFKATCPDRLDPAGPPWDDFARSVAPLVADYADR
VIWGTDWPHPNMQDAIPDDGLVVDMIPRIAPTPELQHKMLVTNPMRLYWSEEME
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2qahA00
MSLTNDERILSWNETPSKPRYTPPPGAIDAHCHVFGPMAQFPFSPKAKYLPRDAGPDMLFALRDHLGFARNVIVQASCHG
TDNAATLDAIARAQGKARGIAVVDPAIDEAELAALHEGGMRGIRFNFLKRLVDDAPKDKFLEVAGRLPAGWHVVIYFEAD
ILEELRPFMDAIPVPIVIDHMGRPDVRQGPDGADMKAFRRLLDSREDIWFKATCPDRLDPAGPPWDDFARSVAPLVADYA
DRVIWGTDWPHPNMQDAIPDDGLVVDMIPRIAPTPELQHKMLVTNPMRLYWSEEMEGHHHHHH
BLAST against CATH

[top]
Domain History Events (148)

Domain assigned by cuff on 08 Apr 2008 12:42

same superfamily

Domain assignment manual match h by tronnberg on 10 Dec 2007 11:39

SSAP: 75.0 OV: 83 SEQ: 10. Very similar linkage, functionally different.

Homcheck review by tronnberg on 10 Dec 2007 11:39

SSAP: 75.0 OV: 83 SEQ: 10. Very similar linkage, functionally different.

Flow stage update by tronnberg on 10 Dec 2007 11:39

SSAP: 75.0 OV: 83 SEQ: 10. Very similar linkage, functionally different.

Homcheck allotment by tronnberg on 10 Dec 2007 11:37

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 10 Dec 2007 11:37

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 09 Dec 2007 14:58

Domain "2qahA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 09 Dec 2007 14:58

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2qahA00

Flow stage update by auto on 08 Dec 2007 14:50

Retrieved PRC_PFAMCATH results for job ID SID4504584959208384 and results inserted.

Domain scan prc pfamcath by auto on 08 Dec 2007 14:50

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 32 results for 2qahA00

Update comment by auto on 08 Dec 2007 03:20

PRC_PFAMCATH job SID4504584959208384 is not yet finished.

Prc pfamcath submit by auto on 08 Dec 2007 03:19

The entry "2qahA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Dec 2007 03:19

The entry "2qahA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 08 Dec 2007 03:01

Retrieved SSAP results for job ID SID7022951320580352 and results inserted.

Domain scan ssap cath by auto on 08 Dec 2007 03:00

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 341 results for 2qahA00

Update comment by auto on 05 Dec 2007 19:06

SSAP job SID7022951320580352 is not yet finished.

Ssap cath submit by auto on 05 Dec 2007 19:01

The entry "2qahA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Dec 2007 19:01

The entry "2qahA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Dec 2007 18:46

Retrieved PRC results for job ID SID3622683506571714 and inserted them into the database.

Domain scan prc cath by auto on 05 Dec 2007 18:46

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 6 results for 2qahA00

Update comment by auto on 05 Dec 2007 15:04

PRC job SID3622683506571714 is not yet finished.

Prc cath submit by auto on 05 Dec 2007 14:56

The entry "2qahA00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Dec 2007 14:56

The entry "2qahA00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Dec 2007 14:44

Retrieved HMM(SAM) results for job ID SID4088420809087008 and inserted them into the database.

Domain scan sam cath by auto on 05 Dec 2007 14:44

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 2qahA00

Update comment by auto on 05 Dec 2007 10:59

HMM(SAM) job SID4088420809087008 is not yet finished.

Sam cath submit by auto on 05 Dec 2007 10:53

The entry "2qahA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 05 Dec 2007 10:53

The entry "2qahA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 05 Dec 2007 10:35

Retrieved "2qahA00" CATHEDRAL results for job ID SID9914186853370924 and inserted them into the database.

Domain scan cathedral cath by auto on 05 Dec 2007 10:35

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 130 results for 2qahA00

Update comment by auto on 05 Dec 2007 06:36

"2qahA00" CATHEDRAL job SID9914186853370924 is not yet finished.

Cathedral cath submit by auto on 05 Dec 2007 06:29

The entry "2qahA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 05 Dec 2007 06:29

The entry "2qahA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 05 Dec 2007 03:19

Unable to insert the domain scan results from "2qahA00" CATHEDRAL job SID4344413035588030.

Update comment by auto on 04 Dec 2007 23:00

"2qahA00" CATHEDRAL job SID4344413035588030 is not yet finished.

Cathedral cath submit by auto on 04 Dec 2007 22:52

The entry "2qahA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 04 Dec 2007 22:52

The entry "2qahA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 04 Dec 2007 22:41

ScanList with 11650 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qahA00.scanlist" for "2qahA00"

Write scan list by auto on 04 Dec 2007 22:41

Writing ScanList containing 11650 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qahA00.scanlist" for domain "2qahA00"

Update comment by auto on 04 Dec 2007 18:15

Waiting for 43 new domains (example : 2z2eB00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 15:07

Waiting for 127 new domains (example : 2z2eB00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 10:15

Waiting for 206 new domains (example : 2vfzA00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 08:39

Waiting for 257 new domains (example : 2rb8A00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 02:36

Waiting for 335 new domains (example : 2r5qA00) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 22:42

Waiting for 410 new domains (example : 2qluA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 18:15

Waiting for 486 new domains (example : 2o2cB01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 14:51

Waiting for 559 new domains (example : 2ihuB03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 10:16

Waiting for 634 new domains (example : 2e2gJ02) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 07:39

Waiting for 665 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 02:42

Waiting for 642 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 22:33

Waiting for 633 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 18:28

Waiting for 582 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 16:54

Waiting for 555 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 10:15

Waiting for 492 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 07:10

Waiting for 574 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 22:15

Waiting for 624 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 18:53

Waiting for 698 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 14:15

Waiting for 787 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 11:42

Waiting for 869 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 06:27

Waiting for 942 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 02:30

Waiting for 1001 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 23:27

Waiting for 1059 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 18:17

Waiting for 1133 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 14:50

Waiting for 1234 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 10:39

Waiting for 1324 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 08:17

Waiting for 1411 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Nov 2007 22:10

Waiting for 1402 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Nov 2007 11:06

Waiting for 1512 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 29 Nov 2007 10:33

Moving these domains back to write scan list as we want to avoid any problems caused by the remediation that occurred whilst they were progressing through their scans.

Update comment by auto on 28 Nov 2007 11:08

PRC_PFAMCATH job SID8242334586968480 is not yet finished.

Prc pfamcath submit by auto on 28 Nov 2007 11:06

The entry "2qahA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 28 Nov 2007 11:06

The entry "2qahA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 28 Nov 2007 06:30

Unable to retrieve "2qahA00" PRC_PFAMCATH results for job "SID2020769381982760"

Update comment by auto on 26 Nov 2007 03:18

PRC_PFAMCATH job SID2020769381982760 is not yet finished.

Prc pfamcath submit by auto on 26 Nov 2007 03:17

The entry "2qahA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 26 Nov 2007 03:17

The entry "2qahA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 25 Nov 2007 22:30

Giving up on PRC_PFAMCATH job SID5006186567174482 because submission time of Wed Nov 21 22:16:28 2007 is more than 345600 seconds older than current time (Sun Nov 25 22:30:29 2007).

Update comment by auto on 21 Nov 2007 22:17

PRC_PFAMCATH job SID5006186567174482 is not yet finished.

Prc pfamcath submit by auto on 21 Nov 2007 22:16

The entry "2qahA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 21 Nov 2007 22:16

The entry "2qahA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 21 Nov 2007 22:15

Retrieved SSAP results for job ID SID1510749297619136 and results inserted.

Domain scan ssap cath by auto on 21 Nov 2007 22:14

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 334 results for 2qahA00

Update comment by auto on 18 Nov 2007 10:17

SSAP job SID1510749297619136 is not yet finished.

Ssap cath submit by auto on 18 Nov 2007 10:15

The entry "2qahA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 18 Nov 2007 10:15

The entry "2qahA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 18 Nov 2007 06:16

Giving up on SSAP job SID6387826568965184 because submission time of Wed Nov 14 02:23:56 2007 is more than 345600 seconds older than current time (Sun Nov 18 06:16:46 2007).

Update comment by auto on 14 Nov 2007 02:25

SSAP job SID6387826568965184 is not yet finished.

Ssap cath submit by auto on 14 Nov 2007 02:23

The entry "2qahA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Nov 2007 02:23

The entry "2qahA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 13 Nov 2007 22:14

Unable to retrieve "2qahA00" SSAP results for job "SID0360176200447616"

Update comment by auto on 13 Nov 2007 12:04

SSAP job SID0360176200447616 is not yet finished.

Ssap cath submit by auto on 13 Nov 2007 11:59

The entry "2qahA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 13 Nov 2007 11:59

The entry "2qahA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 13 Nov 2007 00:49

Unable to retrieve "2qahA00" SSAP results for job "SID9292304179391120"

Update comment by auto on 15 Sep 2007 14:28

SSAP job SID9292304179391120 is not yet finished.

Ssap cath submit by auto on 15 Sep 2007 14:19

The entry "2qahA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 14:19

The entry "2qahA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 08:27

Giving up on SSAP job SID2942470808108576 because submission time of Sun Sep 9 22:52:24 2007 is more than 345600 seconds older than current time (Sat Sep 15 08:27:35 2007).

Update comment by auto on 09 Sep 2007 23:30

SSAP job SID2942470808108576 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:52

The entry "2qahA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:52

The entry "2qahA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:23

Giving up on SSAP job SID6573963550407324 because submission time of Wed Sep 5 19:02:29 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:23:11 2007).

Update comment by auto on 05 Sep 2007 20:06

SSAP job SID6573963550407324 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 19:02

The entry "2qahA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 19:02

The entry "2qahA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 14:36

Retrieved PRC results for job ID SID9359947945999488 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 14:35

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 6 results for 2qahA00

Prc cath submit by auto on 05 Sep 2007 04:38

The entry "2qahA00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 04:38

The entry "2qahA00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 02:17

Retrieved HMM(SAM) results for job ID SID3124868418963712 and inserted them into the database.

Domain scan sam cath by auto on 05 Sep 2007 02:16

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 2qahA00

Update comment by auto on 04 Sep 2007 13:31

HMM(SAM) job SID3124868418963712 is not yet finished.

Flow stage update by auto on 04 Sep 2007 10:38

The entry "2qahA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Sep 2007 10:38

The entry "2qahA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 08:15

Retrieved "2qahA00" CATHEDRAL results for job ID SID6711537078760768 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 08:14

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 129 results for 2qahA00

Flow stage update by auto on 03 Sep 2007 14:38

The entry "2qahA00" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Sep 2007 14:38

The entry "2qahA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:56

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qahA00.scanlist" for "2qahA00"

Write scan list by auto on 03 Sep 2007 12:56

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2qahA00.scanlist" for domain "2qahA00"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:32

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:33

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:23

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:23

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:29

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:13

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:16

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:17

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:42

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:17

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:34

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:08

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:18

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:13

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:33

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:38

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:17

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:43

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:06

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Flow stage update by auto on 29 Aug 2007 06:27

No satisfactory AssignClose result found.

Flow stage update by auto on 29 Aug 2007 06:13

No in_process hits for Domain "2qahA00" ready to be processed

Flow stage update by auto on 29 Aug 2007 06:13

NW result present for Domain "2qahA00"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2qahA00"

Flow stage update by auto on 18 Aug 2007 14:31

Beginning processing for Domain "2qahA00"

Insertion by cuff on 18 Aug 2007 12:35

nice chopping