CATH Domain: 2q9kA00 XML data for domain: 2q9kA00

Molscript image for 2q9kA00
2q9kA00
PDB coordinates for domain 2q9kA00

PDB 2q9k, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.110 Pnp Oxidase; Chain A
2.30.110.10 Electron Transport, Fmn-binding Protein; Chain A Gene3D
2.30.110.10.4
2.30.110.10.4.1
2.30.110.10.4.1.1
2.30.110.10.4.1.1.1
2.30.110.10.4.1.1.1.1

[top]
Segment boundaries for domain 2q9kA00

Chopping figure for domain 2q9kA00
DomainStart PDB ResidueStop PDB Residue
2q9kA00 4 150

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 2.30.110.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2htdB00 80.15 Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842Putative uncharacterized protein 2.30.110.10 121 10 77 3.28 4.24
1flmA00 79.00 FMN-binding proteinDesulfovibrio vulgaris str. 'Miyazaki F' 2.30.110.10 122 9 72 2.58 3.55
2htiA00 78.91 BH0577 proteinBacillus halodurans 2.30.110.10 122 8 78 3.70 4.74
2re7A00 78.39 Psychrobacter arcticus 273-4Putative uncharacterized protein 2.30.110.10 130 11 78 3.71 4.71
2hq9B00 77.18 Mesorhizobium lotiMll6688 protein 2.30.110.10 133 9 73 3.47 4.71
3cp3A00 76.99 Corynebacterium diphtheriaePutative uncharacterized protein 2.30.110.10 127 8 74 3.62 4.88
2rdeB01 73.73 Vibrio cholerae O395Putative uncharacterized protein 2.30.110.10 114 4 74 3.45 4.65
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2q9kA00
KVEHRLSEQQKALTDLPLVFLITHDQSKSWPITHAISWVYAKDETTIRFAIEADSLLVKTLADHPVFTLIFFADQSTYSL
TCTDVAAWETTARLPLKVALYEGQIKEVRDILFYGAAVSDRPRVYKTYDEAAAQLDQQIQDILKG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2q9kA00
GXANKVEHRLSEQQXKALTDLPLVFLITHDQSKSWPITHAISWVYAKDETTIRFAIEADSLLVKTLADHPVFTLIFFADQ
STYSLTCTDVAAWETTARLPLKVALYEGQIKEVRDILFYGAAVSDRPRVYKTYDEAAAXQLDQQIQDILKG
BLAST against CATH

[top]
Domain History Events (57)

Domain assigned by cuff on 07 Mar 2008 13:04

same superfamily

Domain assignment manual match h by cuff on 07 Mar 2008 13:02

ample evidence for homology

Homcheck review by tronnberg on 20 Sep 2007 14:58

SSAP: 79.0 OV: 72 SEQ: 9. Similar linkage and structure (differ with one alfa helix). The query's function is unknown.

Flow stage update by tronnberg on 20 Sep 2007 14:58

SSAP: 79.0 OV: 72 SEQ: 9. Similar linkage and structure (differ with one alfa helix). The query's function is unknown.

Domain assignment manual match t by tronnberg on 20 Sep 2007 14:58

SSAP: 79.0 OV: 72 SEQ: 9. Similar linkage and structure (differ with one alfa helix). The query's function is unknown.

Homcheck allotment by tronnberg on 20 Sep 2007 14:55

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 20 Sep 2007 14:55

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 17 Sep 2007 13:26

Domain "2q9kA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 17 Sep 2007 13:26

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2q9kA00

Flow stage update by auto on 17 Sep 2007 12:27

Retrieved PRC_PFAMCATH results for job ID SID0383277945322233 and results inserted.

Domain scan prc pfamcath by auto on 17 Sep 2007 12:26

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 29 results for 2q9kA00

Update comment by auto on 17 Sep 2007 02:52

PRC_PFAMCATH job SID0383277945322233 is not yet finished.

Prc pfamcath submit by auto on 17 Sep 2007 02:48

The entry "2q9kA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 17 Sep 2007 02:48

The entry "2q9kA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 17 Sep 2007 02:40

Retrieved SSAP results for job ID SID1020684223326128 and results inserted.

Domain scan ssap cath by auto on 17 Sep 2007 02:39

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 896 results for 2q9kA00

Update comment by auto on 15 Sep 2007 14:28

SSAP job SID1020684223326128 is not yet finished.

Ssap cath submit by auto on 15 Sep 2007 14:19

The entry "2q9kA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 14:19

The entry "2q9kA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 08:27

Giving up on SSAP job SID3506023848942880 because submission time of Sun Sep 9 22:52:10 2007 is more than 345600 seconds older than current time (Sat Sep 15 08:27:23 2007).

Update comment by auto on 09 Sep 2007 23:30

SSAP job SID3506023848942880 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:52

The entry "2q9kA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:52

The entry "2q9kA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:22

Giving up on SSAP job SID6863223526810064 because submission time of Wed Sep 5 19:02:15 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:22:57 2007).

Update comment by auto on 05 Sep 2007 20:06

SSAP job SID6863223526810064 is not yet finished.

Flow stage update by auto on 05 Sep 2007 19:02

The entry "2q9kA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 19:02

The entry "2q9kA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 14:34

Retrieved PRC results for job ID SID0258363020661704 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 14:33

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 7 results for 2q9kA00

Prc cath submit by auto on 05 Sep 2007 04:38

The entry "2q9kA00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 04:38

The entry "2q9kA00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 02:15

Retrieved HMM(SAM) results for job ID SID1222137782051584 and inserted them into the database.

Domain scan sam cath by auto on 05 Sep 2007 02:14

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2q9kA00

Update comment by auto on 04 Sep 2007 13:31

HMM(SAM) job SID1222137782051584 is not yet finished.

Flow stage update by auto on 04 Sep 2007 10:38

The entry "2q9kA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Sep 2007 10:38

The entry "2q9kA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 08:12

Retrieved "2q9kA00" CATHEDRAL results for job ID SID9423335210528320 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 08:11

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 35 results for 2q9kA00

Cathedral cath submit by auto on 03 Sep 2007 14:38

The entry "2q9kA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:38

The entry "2q9kA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:56

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2q9kA00.scanlist" for "2q9kA00"

Write scan list by auto on 03 Sep 2007 12:56

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2q9kA00.scanlist" for domain "2q9kA00"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:32

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:33

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:23

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:23

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:29

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:13

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Sep 2007 22:10

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Sep 2007 22:03

No in_process hits for Domain "2q9kA00" ready to be processed

Flow stage update by auto on 01 Sep 2007 22:03

NW result present for Domain "2q9kA00"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2q9kA00"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2q9kA00"

Insertion by cuff on 23 Aug 2007 14:44

nice chopping