CATH Domain: 2q8uA02 XML data for domain: 2q8uA02

Molscript image for 2q8uA02
2q8uA02
PDB coordinates for domain 2q8uA02

PDB 2q8u, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.160 Double Stranded RNA Binding Domain
3.30.160.210 DNA double-strand break repair nuclease Gene3D
3.30.160.210.1
3.30.160.210.1.1
3.30.160.210.1.1.1
3.30.160.210.1.1.1.1
3.30.160.210.1.1.1.1.1

Segment boundaries for domain 2q8uA02

Chopping figure for domain 2q8uA02
DomainStart PDB ResidueStop PDB Residue
2q8uA01 5 270
2q8uA02 271 324

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


Domain ATOM Sequence

>pdb|2q8uA02
PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLGEIDNLVKIE    

Domain COMBS Sequence

>pdb|2q8uA02
PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYEEDSGILPDLXGEIDNLVKIE    

Domain History Events (57)

Domain assigned by cuff on 14 Mar 2009 14:56

same fold -no evidence for homology link

Domain assignment manual match a by cuff on 20 May 2008 14:48

new fold for the time being - not enough evidence for otherwise

Domain assignment manual match t by tronnberg on 20 Sep 2007 14:54

SSAP: 73.0 OV: 48 SEQ: 5. reasonable similar structure and linkage (differ with a beta linkage). The query's function is unknown.

Homcheck review by tronnberg on 20 Sep 2007 14:54

SSAP: 73.0 OV: 48 SEQ: 5. reasonable similar structure and linkage (differ with a beta linkage). The query's function is unknown.

Flow stage update by tronnberg on 20 Sep 2007 14:54

SSAP: 73.0 OV: 48 SEQ: 5. reasonable similar structure and linkage (differ with a beta linkage). The query's function is unknown.

Homcheck allotment by tronnberg on 20 Sep 2007 14:50

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 20 Sep 2007 14:50

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 17 Sep 2007 13:26

Domain "2q8uA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 17 Sep 2007 13:25

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2q8uA02

Flow stage update by auto on 17 Sep 2007 12:26

Retrieved PRC_PFAMCATH results for job ID SID6644205756932112 and results inserted.

Domain scan prc pfamcath by auto on 17 Sep 2007 12:25

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2q8uA02

Update comment by auto on 16 Sep 2007 22:48

PRC_PFAMCATH job SID6644205756932112 is not yet finished.

Prc pfamcath submit by auto on 16 Sep 2007 22:45

The entry "2q8uA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 16 Sep 2007 22:45

The entry "2q8uA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 16 Sep 2007 22:39

Retrieved SSAP results for job ID SID9019394702355488 and results inserted.

Domain scan ssap cath by auto on 16 Sep 2007 22:37

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1876 results for 2q8uA02

Update comment by auto on 15 Sep 2007 14:28

SSAP job SID9019394702355488 is not yet finished.

Flow stage update by auto on 15 Sep 2007 14:19

The entry "2q8uA02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 15 Sep 2007 14:19

The entry "2q8uA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 08:27

Giving up on SSAP job SID9605307076712328 because submission time of Sun Sep 9 22:52:03 2007 is more than 345600 seconds older than current time (Sat Sep 15 08:27:17 2007).

Update comment by auto on 09 Sep 2007 23:30

SSAP job SID9605307076712328 is not yet finished.

Flow stage update by auto on 09 Sep 2007 22:52

The entry "2q8uA02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 09 Sep 2007 22:52

The entry "2q8uA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:22

Giving up on SSAP job SID4118504462271624 because submission time of Wed Sep 5 19:02:06 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:22:49 2007).

Update comment by auto on 05 Sep 2007 20:06

SSAP job SID4118504462271624 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 19:02

The entry "2q8uA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 19:02

The entry "2q8uA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 14:32

Retrieved PRC results for job ID SID0614452686244192 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 14:32

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2q8uA02

Prc cath submit by auto on 05 Sep 2007 04:38

The entry "2q8uA02" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 04:38

The entry "2q8uA02" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 02:14

Retrieved HMM(SAM) results for job ID SID4054796319481152 and inserted them into the database.

Domain scan sam cath by auto on 05 Sep 2007 02:13

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2q8uA02

Update comment by auto on 04 Sep 2007 13:30

HMM(SAM) job SID4054796319481152 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:37

The entry "2q8uA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:37

The entry "2q8uA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 08:11

Retrieved "2q8uA02" CATHEDRAL results for job ID SID7653848194105152 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 08:10

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 22 results for 2q8uA02

Flow stage update by auto on 03 Sep 2007 14:38

The entry "2q8uA02" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Sep 2007 14:38

The entry "2q8uA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:56

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2q8uA02.scanlist" for "2q8uA02"

Write scan list by auto on 03 Sep 2007 12:56

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2q8uA02.scanlist" for domain "2q8uA02"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:32

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:33

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:23

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:23

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:29

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:13

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Sep 2007 22:10

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Sep 2007 22:03

No in_process hits for Domain "2q8uA02" ready to be processed

Flow stage update by auto on 01 Sep 2007 22:03

NW result present for Domain "2q8uA02"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2q8uA02"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2q8uA02"

Insertion by cuff on 23 Aug 2007 14:44

nice chopping