CATH Domain: 2q8oA00 XML data for domain: 2q8oA00

Molscript image for 2q8oA00
2q8oA00
PDB coordinates for domain 2q8oA00

PDB 2q8o, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.120 Jelly Rolls
2.60.120.40 Gene3D
2.60.120.40.6
2.60.120.40.6.1
2.60.120.40.6.1.1
2.60.120.40.6.1.1.1
2.60.120.40.6.1.1.1.1

[top]
Segment boundaries for domain 2q8oA00

Chopping figure for domain 2q8oA00
DomainStart PDB ResidueStop PDB Residue
2q8oA00 49 173

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 2.60.120.40.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1o91A00 83.73 Mus musculusCamera-type eye morphogenesisCollagen alpha-1(VIII) chainEpithelial cell proliferationPositive regulation of cell-substrate adhesion 2.60.120.40 131 14 83 2.75 3.27
1tnrA00 82.82 Lymphotoxin-alphaType I diabetes mellitusSignal transductionLymphotoxin alpha (TNF superfamily, member 1)Induction of apoptosis 2.60.120.40 144 12 77 2.45 3.18
1rj8A00 82.72 Membrane fractionEctodysplasin-ACytoskeletonSignal transductionEctodysplasin-A 2.60.120.40 140 19 80 2.61 3.23
1s55A00 81.68 Mammary gland epithelial cell proliferationOssificationOrgan morphogenesisLymph node developmentProtein homooligomerization 2.60.120.40 156 17 76 3.66 4.76
1uzvA00 75.53 Pseudomonas aeruginosaFucose-binding lectin PA-IIL 2.60.120.400 114 6 68 3.28 4.82
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2q8oA00
IESCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQ
ILPIGGVYELHAGDNIYLKFNSKDHIQKNNTYWGIILMPDLPFIS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2q8oA00
DRWGSSLKPTAIESCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKN
DVLQTLMNDFQILPIGGVYELHAGDNIYLKFNSKDHIQKNNTYWGIILMPDLPFIS
BLAST against CATH

[top]
Domain History Events (14)

Domain assigned by auto on 18 Feb 2009 21:31

Assigning to "2.60.120.40" based on similarity with "2qdnB00"

Flow stage update by auto on 18 Feb 2009 21:28

No in_process hits for Domain "2q8oA00" ready to be processed

Update comment by auto on 18 Feb 2009 21:02

Domain "2q8oA00" hits Domain "2q1mA00" (55.3846153846154% over 95.5882352941177%) which is currently in process

Update comment by auto on 18 Feb 2009 20:33

Domain "2q8oA00" hits Domain "3b9iA00" (96.969696969697% over 97.0588235294118%) which is currently in process

Update comment by auto on 18 Feb 2009 20:06

Domain "2q8oA00" hits Domain "3b9iB00" (96.969696969697% over 97.0588235294118%) which is currently in process

Update comment by auto on 18 Feb 2009 19:35

Domain "2q8oA00" hits Domain "2r30A00" (55.3846153846154% over 95.5882352941177%) which is currently in process

Update comment by auto on 18 Feb 2009 19:10

Domain "2q8oA00" hits Domain "2qdnA00" (96.969696969697% over 97.0588235294118%) which is currently in process

Update comment by auto on 18 Feb 2009 18:39

Domain "2q8oA00" hits Domain "2qdnB00" (96.969696969697% over 97.0588235294118%) which is currently in process

Update comment by auto on 12 Dec 2008 20:50

Domain "2q8oA00" hits Domain "2r32A02" (56.198347107438% over 88.9705882352941%) which is currently in process

Flow stage update by auto on 12 Dec 2008 20:36

Domain "2q8oA00" hits Domain "2r32A02" (56.198347107438% over 88.9705882352941%) which is currently in process

Flow stage update by auto on 12 Dec 2008 20:36

NW result present for Domain "2q8oA00"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "2q8oA00"

Flow stage update by auto on 10 Dec 2008 14:15

Beginning processing for Domain "2q8oA00"

Insertion by auto on 08 Dec 2008 15:17

Final ChopClose added based on similarity with "2q8oB"