Domain assigned by cuff on 14 Apr 2008 10:41
same superfamily
CATH Domain: 2q83A02
2q83A02
PDB 2q83, Chain A, Domain 2
Segment boundaries for domain 2q83A02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2q83A01 | 22 | 124 |
| 2q83A02 | 125 | 357 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2q83A02 EGRPFELTVKQDLEFIKGLADFHTASVGYQPPNGVPIFTKLGRWPNHYTKRCKQETWKLAEAEKEDPFSQLYLQEIDGFI EDGLRIKDRLLQSTYVPWTEQLKKSPNLCHQDYGTGNTLLGENEQIWVIDLDTVSFDLPIRDLRKIIPLLDTTGVWDDET FNVLNAYESRAPLTEEQKQVFIDLFPYELYDVIREKYVRKSALPKEELESAFEYERIKANALRQLI
Domain History Events (140)
Domain assignment manual match h by cuff on 14 Apr 2008 10:40
reasonable scores and same function
Domain assignment manual match t by tronnberg on 10 Dec 2007 11:27
SSAP: 73.0 OV: 75 SEQ: 12. Different functions, but reasonable similar linkage.
Homcheck review by tronnberg on 10 Dec 2007 11:27
SSAP: 73.0 OV: 75 SEQ: 12. Different functions, but reasonable similar linkage.
Flow stage update by tronnberg on 10 Dec 2007 11:27
SSAP: 73.0 OV: 75 SEQ: 12. Different functions, but reasonable similar linkage.
Homcheck allotment by tronnberg on 10 Dec 2007 11:21
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 10 Dec 2007 11:21
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 09 Dec 2007 14:57
Domain "2q83A02" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 09 Dec 2007 14:57
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2q83A02
Flow stage update by auto on 07 Dec 2007 19:53
Retrieved PRC_PFAMCATH results for job ID SID9861507896621412 and results inserted.
Domain scan prc pfamcath by auto on 07 Dec 2007 19:52
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 392 results for 2q83A02
Update comment by auto on 06 Dec 2007 22:28
PRC_PFAMCATH job SID9861507896621412 is not yet finished.
Flow stage update by auto on 06 Dec 2007 22:27
The entry "2q83A02" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 06 Dec 2007 22:27
The entry "2q83A02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 06 Dec 2007 22:23
Retrieved SSAP results for job ID SID1286330671269424 and results inserted.
Domain scan ssap cath by auto on 06 Dec 2007 22:22
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 159 results for 2q83A02
Update comment by auto on 05 Dec 2007 19:06
SSAP job SID1286330671269424 is not yet finished.
Ssap cath submit by auto on 05 Dec 2007 19:00
The entry "2q83A02" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Dec 2007 19:00
The entry "2q83A02" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Dec 2007 18:46
Retrieved PRC results for job ID SID2934040019110528 and inserted them into the database.
Domain scan prc cath by auto on 05 Dec 2007 18:45
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 38 results for 2q83A02
Update comment by auto on 05 Dec 2007 15:03
PRC job SID2934040019110528 is not yet finished.
Prc cath submit by auto on 05 Dec 2007 14:56
The entry "2q83A02" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Dec 2007 14:56
The entry "2q83A02" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Dec 2007 14:44
Retrieved HMM(SAM) results for job ID SID4356578069835328 and inserted them into the database.
Domain scan sam cath by auto on 05 Dec 2007 14:43
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 4 results for 2q83A02
Update comment by auto on 05 Dec 2007 10:59
HMM(SAM) job SID4356578069835328 is not yet finished.
Flow stage update by auto on 05 Dec 2007 10:53
The entry "2q83A02" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 05 Dec 2007 10:53
The entry "2q83A02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 05 Dec 2007 10:35
Retrieved "2q83A02" CATHEDRAL results for job ID SID0315973580445081 and inserted them into the database.
Domain scan cathedral cath by auto on 05 Dec 2007 10:34
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 67 results for 2q83A02
Update comment by auto on 05 Dec 2007 06:36
"2q83A02" CATHEDRAL job SID0315973580445081 is not yet finished.
Cathedral cath submit by auto on 05 Dec 2007 06:29
The entry "2q83A02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 05 Dec 2007 06:29
The entry "2q83A02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 05 Dec 2007 03:17
Unable to insert the domain scan results from "2q83A02" CATHEDRAL job SID7110150677025508.
Update comment by auto on 04 Dec 2007 23:00
"2q83A02" CATHEDRAL job SID7110150677025508 is not yet finished.
Cathedral cath submit by auto on 04 Dec 2007 22:51
The entry "2q83A02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 04 Dec 2007 22:51
The entry "2q83A02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 04 Dec 2007 22:41
ScanList with 11650 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2q83A02.scanlist" for "2q83A02"
Write scan list by auto on 04 Dec 2007 22:41
Writing ScanList containing 11650 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2q83A02.scanlist" for domain "2q83A02"
Update comment by auto on 04 Dec 2007 18:15
Waiting for 43 new domains (example : 2z2eB00) to be processed so that they can be scanned against too.
Update comment by auto on 04 Dec 2007 15:07
Waiting for 127 new domains (example : 2z2eB00) to be processed so that they can be scanned against too.
Update comment by auto on 04 Dec 2007 10:15
Waiting for 206 new domains (example : 2vfzA00) to be processed so that they can be scanned against too.
Update comment by auto on 04 Dec 2007 08:39
Waiting for 257 new domains (example : 2rb8A00) to be processed so that they can be scanned against too.
Update comment by auto on 04 Dec 2007 02:36
Waiting for 335 new domains (example : 2r5qA00) to be processed so that they can be scanned against too.
Update comment by auto on 03 Dec 2007 22:42
Waiting for 410 new domains (example : 2qluA01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Dec 2007 18:15
Waiting for 486 new domains (example : 2o2cB01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Dec 2007 14:51
Waiting for 559 new domains (example : 2ihuB03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Dec 2007 10:16
Waiting for 634 new domains (example : 2e2gJ02) to be processed so that they can be scanned against too.
Update comment by auto on 03 Dec 2007 07:39
Waiting for 665 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 03 Dec 2007 02:42
Waiting for 642 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2007 22:33
Waiting for 633 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2007 18:28
Waiting for 582 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2007 16:54
Waiting for 555 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2007 10:15
Waiting for 492 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2007 07:10
Waiting for 574 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2007 22:15
Waiting for 624 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2007 18:53
Waiting for 698 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2007 14:15
Waiting for 787 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2007 11:42
Waiting for 869 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2007 06:27
Waiting for 942 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 01 Dec 2007 02:30
Waiting for 1001 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 30 Nov 2007 23:27
Waiting for 1059 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 30 Nov 2007 18:17
Waiting for 1133 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 30 Nov 2007 14:50
Waiting for 1234 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 30 Nov 2007 10:39
Waiting for 1324 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 30 Nov 2007 08:17
Waiting for 1411 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 29 Nov 2007 22:10
Waiting for 1402 new domains (example : 1vspE00) to be processed so that they can be scanned against too.
Update comment by auto on 29 Nov 2007 11:06
Waiting for 1512 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Flow stage update by auto on 29 Nov 2007 10:33
Moving these domains back to write scan list as we want to avoid any problems caused by the remediation that occurred whilst they were progressing through their scans.
Update comment by auto on 28 Nov 2007 22:33
PRC_PFAMCATH job SID8146288154300424 is not yet finished.
Prc pfamcath submit by auto on 28 Nov 2007 22:30
The entry "2q83A02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 28 Nov 2007 22:30
The entry "2q83A02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 28 Nov 2007 18:46
Unable to retrieve "2q83A02" PRC_PFAMCATH results for job "SID8663614543588557"
Update comment by auto on 27 Nov 2007 22:30
PRC_PFAMCATH job SID8663614543588557 is not yet finished.
Flow stage update by auto on 27 Nov 2007 22:27
The entry "2q83A02" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 27 Nov 2007 22:27
The entry "2q83A02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 27 Nov 2007 20:04
Unable to retrieve "2q83A02" PRC_PFAMCATH results for job "SID6241748254435840"
Update comment by auto on 24 Nov 2007 22:31
PRC_PFAMCATH job SID6241748254435840 is not yet finished.
Prc pfamcath submit by auto on 24 Nov 2007 22:30
The entry "2q83A02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 24 Nov 2007 22:30
The entry "2q83A02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 24 Nov 2007 21:14
Giving up on PRC_PFAMCATH job SID6146019010212243 because submission time of Tue Nov 20 18:32:34 2007 is more than 345600 seconds older than current time (Sat Nov 24 21:14:55 2007).
Update comment by auto on 20 Nov 2007 18:33
PRC_PFAMCATH job SID6146019010212243 is not yet finished.
Prc pfamcath submit by auto on 20 Nov 2007 18:32
The entry "2q83A02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 20 Nov 2007 18:32
The entry "2q83A02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 20 Nov 2007 18:24
Retrieved SSAP results for job ID SID3796590250771044 and results inserted.
Domain scan ssap cath by auto on 20 Nov 2007 18:24
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 152 results for 2q83A02
Update comment by auto on 18 Nov 2007 02:21
SSAP job SID3796590250771044 is not yet finished.
Flow stage update by auto on 18 Nov 2007 02:17
The entry "2q83A02" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 18 Nov 2007 02:17
The entry "2q83A02" has been submitted to the SSAP webservice.
Flow stage update by auto on 17 Nov 2007 22:15
Giving up on SSAP job SID7997679229695856 because submission time of Tue Nov 13 22:11:27 2007 is more than 345600 seconds older than current time (Sat Nov 17 22:15:58 2007).
Update comment by auto on 13 Nov 2007 22:13
SSAP job SID7997679229695856 is not yet finished.
Flow stage update by auto on 13 Nov 2007 22:11
The entry "2q83A02" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 13 Nov 2007 22:11
The entry "2q83A02" has been submitted to the SSAP webservice.
Flow stage update by auto on 13 Nov 2007 18:36
Unable to retrieve "2q83A02" SSAP results for job "SID6606397720171288"
Update comment by auto on 13 Nov 2007 12:04
SSAP job SID6606397720171288 is not yet finished.
Ssap cath submit by auto on 13 Nov 2007 11:59
The entry "2q83A02" has been submitted to the SSAP webservice.
Flow stage update by auto on 13 Nov 2007 11:59
The entry "2q83A02" has been submitted to the SSAP webservice.
Flow stage update by auto on 13 Nov 2007 00:48
Unable to retrieve "2q83A02" SSAP results for job "SID5010257501694257"
Update comment by auto on 15 Sep 2007 14:28
SSAP job SID5010257501694257 is not yet finished.
Ssap cath submit by auto on 15 Sep 2007 14:19
The entry "2q83A02" has been submitted to the SSAP webservice.
Flow stage update by auto on 15 Sep 2007 14:19
The entry "2q83A02" has been submitted to the SSAP webservice.
Flow stage update by auto on 15 Sep 2007 08:27
Giving up on SSAP job SID8399234595677248 because submission time of Sun Sep 9 22:51:50 2007 is more than 345600 seconds older than current time (Sat Sep 15 08:27:05 2007).
Update comment by auto on 09 Sep 2007 23:29
SSAP job SID8399234595677248 is not yet finished.
Ssap cath submit by auto on 09 Sep 2007 22:51
The entry "2q83A02" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 22:51
The entry "2q83A02" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 20:22
Giving up on SSAP job SID5691122307855252 because submission time of Wed Sep 5 19:01:52 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:22:33 2007).
Update comment by auto on 05 Sep 2007 20:05
SSAP job SID5691122307855252 is not yet finished.
Flow stage update by auto on 05 Sep 2007 19:01
The entry "2q83A02" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 05 Sep 2007 19:01
The entry "2q83A02" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 14:30
Retrieved PRC results for job ID SID7511656017816372 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 14:30
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 38 results for 2q83A02
Flow stage update by auto on 05 Sep 2007 04:38
The entry "2q83A02" has been submitted to the PRC webservice.
Prc cath submit by auto on 05 Sep 2007 04:38
The entry "2q83A02" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 02:12
Retrieved HMM(SAM) results for job ID SID5682335213546208 and inserted them into the database.
Domain scan sam cath by auto on 05 Sep 2007 02:11
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 5 results for 2q83A02
Update comment by auto on 04 Sep 2007 13:30
HMM(SAM) job SID5682335213546208 is not yet finished.
Sam cath submit by auto on 04 Sep 2007 10:37
The entry "2q83A02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 10:37
The entry "2q83A02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 08:08
Retrieved "2q83A02" CATHEDRAL results for job ID SID1963977785906232 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 08:07
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 67 results for 2q83A02
Cathedral cath submit by auto on 03 Sep 2007 14:38
The entry "2q83A02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 14:38
The entry "2q83A02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 12:56
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2q83A02.scanlist" for "2q83A02"
Write scan list by auto on 03 Sep 2007 12:56
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2q83A02.scanlist" for domain "2q83A02"
Update comment by auto on 03 Sep 2007 10:11
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:32
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:37
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:33
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:23
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:23
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:16
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:29
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:13
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Flow stage update by auto on 01 Sep 2007 22:09
No satisfactory AssignClose result found.
Flow stage update by auto on 01 Sep 2007 22:03
No in_process hits for Domain "2q83A02" ready to be processed
Flow stage update by auto on 01 Sep 2007 22:03
NW result present for Domain "2q83A02"
Flow stage update by auto on 25 Aug 2007 10:04
All required files are present for Domain "2q83A02"
Flow stage update by auto on 24 Aug 2007 18:10
Beginning processing for Domain "2q83A02"
Insertion by cuff on 24 Aug 2007 15:16
nice chopping
