CATH Domain: 2q7bA00 XML data for domain: 2q7bA00

Molscript image for 2q7bA00
2q7bA00
PDB coordinates for domain 2q7bA00

PDB 2q7b, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.630 Aminopeptidase
3.40.630.30 Gene3D
3.40.630.30.27
3.40.630.30.27.1
3.40.630.30.27.1.1
3.40.630.30.27.1.1.1
3.40.630.30.27.1.1.1.1

Segment boundaries for domain 2q7bA00

Chopping figure for domain 2q7bA00
DomainStart PDB ResidueStop PDB Residue
2q7bA00 -2 161

Structural Neighbourhood (29 entries)

There are 29 matching structural neighberhood comparisons for CATH ID 3.40.630.30.27.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 29 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3d8pB00 90.74 Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein 3.40.630.30 157 32 95 1.39 1.45
3k9uA00 87.59 Putative uncharacterized protein Ta0374Thermoplasma acidophilum 3.40.630.30 159 17 88 2.41 2.71
2fiwA00 85.54 Putative acetyltransferase [EC:2.3.1.-]GCN5-related N-acetyltransferase:Aminotransferase, class-IIRhodopseudomonas palustris 3.40.630.30 156 12 84 2.68 3.17
3g8wA00 85.33 Staphylococcus epidermidis ATCC 12228Lactococcal prophage ps3 protein 05 3.40.630.30 158 12 92 4.40 4.75
2fiaA00 85.10 Acetyltransferase, GNAT familyEnterococcus faecalis 3.40.630.30 157 17 86 2.31 2.66
1s3zA00 84.02 Salmonella enterica subsp. enterica serovar EnteritidisAminoglycoside 6'-N-acetyltransferase 3.40.630.30 147 12 85 3.91 4.59
2i00C01 83.82 Acetyltransferase, GNAT familyEnterococcus faecalis 3.40.630.30 144 15 79 2.97 3.74
1q2yA00 83.63 Bacillus subtilisUncharacterized N-acetyltransferase yjcF 3.40.630.30 140 14 86 3.66 4.24
1qsmD00 83.33 CytoplasmIdentical protein bindingSaccharomyces cerevisiaeHistone acetyltransferase activityHistone acetyltransferase HPA2 3.40.630.30 152 13 86 3.63 4.20
2pdoA01 83.27 Shigella flexneriAcetyltransferase ypeA 3.40.630.30 118 20 72 2.06 2.86
3efaA00 82.48 Tyrosine metabolismBenzoate degradation via CoA ligationLactobacillus plantarumAcetyltransferase (Putative)Limonene and pinene degradation 3.40.630.30 141 17 85 3.46 4.04
1xebA00 82.48 Pseudomonas aeruginosaElaA proteinPutative uncharacterized protein 3.40.630.30 146 15 86 3.46 4.01
3eo4A00 82.01 Methanocaldococcus jannaschiiUncharacterized protein MJ1062 3.40.630.30 155 14 85 2.99 3.51
1y7rA00 81.53 Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein 3.40.630.30 125 8 76 2.83 3.70
2ozgA01 81.10 Anabaena variabilis ATCC 29413GCN5-related N-acetyltransferase 3.40.630.30 117 17 70 2.70 3.81
2pr1A00 80.97 Uncharacterized N-acetyltransferase ylbPBacillus subtilis 3.40.630.30 152 13 78 3.03 3.87
2r1iA01 80.60 Arthrobacter sp. FB24GCN5-related N-acetyltransferase 3.40.630.30 129 15 75 3.09 4.11
3f5bA00 80.52 Aminoglycoside N(6')acetyltransferaseLegionella pneumophila subsp. pneumophila str. Philadelphia 1 3.40.630.30 163 14 89 4.21 4.70
1bo4A00 80.38 Aminoglycoside-(3)-N-acetyltransferaseSerratia marcescens 3.40.630.30 136 11 77 3.31 4.26
1yreC00 80.12 Pseudomonas aeruginosaPutative uncharacterized protein 3.40.630.30 182 11 83 3.46 4.14
1lrzA01 79.08 Peptidoglycan biosynthesisMetabolic pathwaysPeptidoglycan pentaglycine glycine transferase (the second and third glycine) [EC:2.3.2.-]Aminoacyltransferase femAStaphylococcus aureus 3.40.630.30 143 8 77 3.65 4.74
1sqhA02 78.88 Drosophila melanogasterCG14615 3.40.630.30 128 9 70 2.69 3.83
1iykA01 78.49 Glycylpeptide N-tetradecanoyltransferaseCandida albicans 3.40.630.30 147 11 68 3.23 4.68
2fl4A02 78.43 Arginine and proline metabolismSpermine/spermidine acetyltransferase, putativeDiamine N-acetyltransferase [EC:2.3.1.57]Metabolic pathwaysEnterococcus faecalis 3.40.630.30 104 12 62 2.83 4.51
2qmlA00 77.42 BH2621 proteinBacillus halodurans 3.40.630.30 184 9 73 3.27 4.46
2q0yA01 77.18 Ralstonia eutropha JMP134GCN5-related N-acetyltransferase 3.40.630.30 125 12 68 3.03 4.39
1rxtC01 76.94 Glycylpeptide N-tetradecanoyltransferase [EC:2.3.1.97]Protein lipoylationHomo sapiensGlycylpeptide N-tetradecanoyltransferase 1 3.40.630.30 132 10 75 3.55 4.72
1lrzA02 75.75 Peptidoglycan biosynthesisMetabolic pathwaysPeptidoglycan pentaglycine glycine transferase (the second and third glycine) [EC:2.3.2.-]Aminoacyltransferase femAStaphylococcus aureus 3.40.630.30 195 8 62 2.54 4.06
2ozgA02 74.49 Anabaena variabilis ATCC 29413GCN5-related N-acetyltransferase 3.40.630.30 163 4 81 3.95 4.84
Displaying entries 1 to 29 (page 1 of 1)


Domain ATOM Sequence

>pdb|2q7bA00
FQGEIKEYENNPYHLAQLVDLINYCQNIEAKLDIKAEQDDIFQIENYYQNRKGQFWIALENEKVVGSIALLRIDDKTAVL
KKFFTYPKYRGNPVRLGRKLFERFLFARASKFTRIVLDTPEKEKRSHFFYENQGFKQITRDELDVDYIFPDRDSRIYVKL
L    

Domain COMBS Sequence

>pdb|2q7bA00
FQGXEIKEYENNPYHLAQLVDLINYCQNIEAKLDIKXAEQDDIFQIENYYQNRKGQFWIALENEKVVGSIALLRIDDKTA
VLKKFFTYPKYRGNPVRLGRKLFERFXLFARASKFTRIVLDTPEKEKRSHFFYENQGFKQITRDELDVDYIFPDRDSRIY
VKLLD    

Domain History Events (56)

Domain assigned by cuff on 15 Feb 2008 16:31

same superfamily

Domain assignment manual match h by tronnberg on 20 Sep 2007 14:41

SSAP: 85.0 OV: 89 SEQ: 17. Similar linkage and structure. Share the same function as acetyltransferase.

Homcheck review by tronnberg on 20 Sep 2007 14:41

SSAP: 85.0 OV: 89 SEQ: 17. Similar linkage and structure. Share the same function as acetyltransferase.

Flow stage update by tronnberg on 20 Sep 2007 14:41

SSAP: 85.0 OV: 89 SEQ: 17. Similar linkage and structure. Share the same function as acetyltransferase.

Homcheck allotment by tronnberg on 20 Sep 2007 14:38

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 20 Sep 2007 14:38

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 17 Sep 2007 13:24

Domain "2q7bA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 17 Sep 2007 13:23

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2q7bA00

Flow stage update by auto on 17 Sep 2007 12:24

Retrieved PRC_PFAMCATH results for job ID SID2895130172750152 and results inserted.

Domain scan prc pfamcath by auto on 17 Sep 2007 12:23

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 299 results for 2q7bA00

Update comment by auto on 17 Sep 2007 10:43

PRC_PFAMCATH job SID2895130172750152 is not yet finished.

Flow stage update by auto on 17 Sep 2007 10:38

The entry "2q7bA00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 17 Sep 2007 10:38

The entry "2q7bA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 17 Sep 2007 10:20

Retrieved SSAP results for job ID SID8617255959917504 and results inserted.

Domain scan ssap cath by auto on 17 Sep 2007 10:17

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 920 results for 2q7bA00

Update comment by auto on 15 Sep 2007 14:28

SSAP job SID8617255959917504 is not yet finished.

Ssap cath submit by auto on 15 Sep 2007 14:18

The entry "2q7bA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 14:18

The entry "2q7bA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 08:26

Giving up on SSAP job SID9125555249694064 because submission time of Sun Sep 9 22:51:27 2007 is more than 345600 seconds older than current time (Sat Sep 15 08:26:47 2007).

Update comment by auto on 09 Sep 2007 23:29

SSAP job SID9125555249694064 is not yet finished.

Flow stage update by auto on 09 Sep 2007 22:51

The entry "2q7bA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 09 Sep 2007 22:51

The entry "2q7bA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:22

Giving up on SSAP job SID7065164234528024 because submission time of Wed Sep 5 19:01:31 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:22:13 2007).

Update comment by auto on 05 Sep 2007 20:05

SSAP job SID7065164234528024 is not yet finished.

Flow stage update by auto on 05 Sep 2007 19:01

The entry "2q7bA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 19:01

The entry "2q7bA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 14:27

Retrieved PRC results for job ID SID2804750846609536 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 14:26

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 64 results for 2q7bA00

Prc cath submit by auto on 05 Sep 2007 04:37

The entry "2q7bA00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 04:37

The entry "2q7bA00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 02:09

Retrieved HMM(SAM) results for job ID SID9193345863460288 and inserted them into the database.

Domain scan sam cath by auto on 05 Sep 2007 02:08

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 46 results for 2q7bA00

Update comment by auto on 04 Sep 2007 13:30

HMM(SAM) job SID9193345863460288 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:37

The entry "2q7bA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:37

The entry "2q7bA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 08:04

Retrieved "2q7bA00" CATHEDRAL results for job ID SID7187079875624320 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 08:03

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 31 results for 2q7bA00

Cathedral cath submit by auto on 03 Sep 2007 14:37

The entry "2q7bA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:37

The entry "2q7bA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:55

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2q7bA00.scanlist" for "2q7bA00"

Write scan list by auto on 03 Sep 2007 12:55

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2q7bA00.scanlist" for domain "2q7bA00"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:32

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:33

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:23

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:23

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:29

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:13

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Sep 2007 22:09

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Sep 2007 22:03

No in_process hits for Domain "2q7bA00" ready to be processed

Flow stage update by auto on 01 Sep 2007 22:03

NW result present for Domain "2q7bA00"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2q7bA00"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2q7bA00"

Insertion by cuff on 23 Aug 2007 14:44

nice chopping