Domain assigned by cuff on 15 Feb 2008 16:31
same superfamily
| CATH Code | Level Description | Links |
|---|---|---|
3
| Alpha Beta | |
3.40
| 3-Layer(aba) Sandwich | |
3.40.630
| Aminopeptidase | |
3.40.630.30
| Gene3D | |
3.40.630.30.27
| ||
3.40.630.30.27.1
| ||
3.40.630.30.27.1.1
| ||
3.40.630.30.27.1.1.1
| ||
3.40.630.30.27.1.1.1.1
|
There are 29 matching structural neighberhood comparisons for CATH ID 3.40.630.30.27.1.1.1.1 (SIMAX score < 5)
>pdb|2q7bA00 FQGEIKEYENNPYHLAQLVDLINYCQNIEAKLDIKAEQDDIFQIENYYQNRKGQFWIALENEKVVGSIALLRIDDKTAVL KKFFTYPKYRGNPVRLGRKLFERFLFARASKFTRIVLDTPEKEKRSHFFYENQGFKQITRDELDVDYIFPDRDSRIYVKL L
same superfamily
SSAP: 85.0 OV: 89 SEQ: 17. Similar linkage and structure. Share the same function as acetyltransferase.
SSAP: 85.0 OV: 89 SEQ: 17. Similar linkage and structure. Share the same function as acetyltransferase.
SSAP: 85.0 OV: 89 SEQ: 17. Similar linkage and structure. Share the same function as acetyltransferase.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "2q7bA00" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2q7bA00
Retrieved PRC_PFAMCATH results for job ID SID2895130172750152 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 299 results for 2q7bA00
PRC_PFAMCATH job SID2895130172750152 is not yet finished.
The entry "2q7bA00" has been submitted to the PRC_PFAMCATH webservice.
The entry "2q7bA00" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID8617255959917504 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 920 results for 2q7bA00
SSAP job SID8617255959917504 is not yet finished.
The entry "2q7bA00" has been submitted to the SSAP webservice.
The entry "2q7bA00" has been submitted to the SSAP webservice.
Giving up on SSAP job SID9125555249694064 because submission time of Sun Sep 9 22:51:27 2007 is more than 345600 seconds older than current time (Sat Sep 15 08:26:47 2007).
SSAP job SID9125555249694064 is not yet finished.
The entry "2q7bA00" has been submitted to the SSAP webservice.
The entry "2q7bA00" has been submitted to the SSAP webservice.
Giving up on SSAP job SID7065164234528024 because submission time of Wed Sep 5 19:01:31 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:22:13 2007).
SSAP job SID7065164234528024 is not yet finished.
The entry "2q7bA00" has been submitted to the SSAP webservice.
The entry "2q7bA00" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID2804750846609536 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 64 results for 2q7bA00
The entry "2q7bA00" has been submitted to the PRC webservice.
The entry "2q7bA00" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID9193345863460288 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 46 results for 2q7bA00
HMM(SAM) job SID9193345863460288 is not yet finished.
The entry "2q7bA00" has been submitted to the HMM (SAM) webservice.
The entry "2q7bA00" has been submitted to the HMM (SAM) webservice.
Retrieved "2q7bA00" CATHEDRAL results for job ID SID7187079875624320 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 31 results for 2q7bA00
The entry "2q7bA00" has been submitted to the CATHEDRAL webservice.
The entry "2q7bA00" has been submitted to the CATHEDRAL webservice.
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2q7bA00.scanlist" for "2q7bA00"
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2q7bA00.scanlist" for domain "2q7bA00"
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "2q7bA00" ready to be processed
NW result present for Domain "2q7bA00"
All required files are present for Domain "2q7bA00"
Beginning processing for Domain "2q7bA00"
nice chopping