CATH Domain: 2q5iA03 XML data for domain: 2q5iA03

Molscript image for 2q5iA03
2q5iA03
PDB coordinates for domain 2q5iA03

PDB 2q5i, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.800 Gene3D
3.40.50.800.8
3.40.50.800.8.1
3.40.50.800.8.1.1
3.40.50.800.8.1.1.2
3.40.50.800.8.1.1.2.1

[top]
Segment boundaries for domain 2q5iA03

Chopping figure for domain 2q5iA03
DomainStart PDB ResidueStop PDB Residue
2q5iA01 64 142
2q5iA01 227 552
2q5iA02 143 226
2q5iA03 553 673

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.40.50.800.8.1.1.2.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1qe0A02 81.87 Aminoacyl-tRNA biosynthesisHistidyl-tRNA synthetaseHistidyl-tRNA synthetase [EC:6.1.1.21]Staphylococcus aureus 3.40.50.800 91 12 75 2.27 3.02
1nbwB00 80.63 Klebsiella pneumoniaePutative uncharacterized protein 3.40.50.10150 113 10 82 3.44 4.16
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2q5iA03
FPAVVAPFKCSVLPLSQNQEFMPFVKELLEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATL
RDRDSMRQIRAEISELPSIVQDLANGNITWADVEARYPLFE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2q5iA03
FPAVVAPFKCSVLPLSQNQEFMPFVKELLEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATL
RDRDSMRQIRAEISELPSIVQDLANGNITWADVEARYPLFE
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 16 Mar 2009 17:27

Assigning to "3.40.50.800" based on similarity with "2q5hA03"

Flow stage update by auto on 16 Mar 2009 17:24

No in_process hits for Domain "2q5iA03" ready to be processed

Update comment by auto on 12 Dec 2008 20:38

Domain "2q5iA03" hits Domain "2q5hA03" (99.1735537190083% over 100%) which is currently in process

Flow stage update by auto on 12 Dec 2008 20:36

Domain "2q5iA03" hits Domain "2q5hA03" (99.1735537190083% over 100%) which is currently in process

Flow stage update by auto on 12 Dec 2008 20:35

NW result present for Domain "2q5iA03"

Flow stage update by auto on 10 Dec 2008 14:15

All required files are present for Domain "2q5iA03"

Flow stage update by auto on 10 Dec 2008 14:14

Beginning processing for Domain "2q5iA03"

Insertion by auto on 08 Dec 2008 17:54

Final ChopClose added based on similarity with "2q5hA"