CATH Domain: 2q5cA01 XML data for domain: 2q5cA01

Molscript image for 2q5cA01
2q5cA01
PDB coordinates for domain 2q5cA01

PDB 2q5c, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.2300 Gene3D
3.40.50.2300.69
3.40.50.2300.69.1
3.40.50.2300.69.1.1
3.40.50.2300.69.1.1.1
3.40.50.2300.69.1.1.1.1

[top]
Segment boundaries for domain 2q5cA01

Chopping figure for domain 2q5cA01
DomainStart PDB ResidueStop PDB Residue
2q5cA01 0 75
2q5cA01 166 186
2q5cA02 76 165

Structural Neighbourhood (39 entries)

There are 39 matching structural neighberhood comparisons for CATH ID 3.40.50.2300.69.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 39 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2pjuC01 88.02 Positive regulation of gene-specific transcriptionPropionate catabolism operon regulatory proteinNegative regulation of gene-specific transcriptionEscherichia coli K-12Specific transcriptional repressor activity 3.40.50.2300 100 20 93 2.24 2.41
2r4qA00 81.42 PTS system fructose-specific EIIABC componentPTS system, fructose-specific IIB component [EC:2.7.1.69]Bacillus subtilisFructose and mannose metabolismPTS system, fructose-specific IIA component [EC:2.7.1.69] 3.40.50.2300 98 11 90 4.52 4.98
2fepA01 81.10 Bacillus subtilisCatabolite control protein ALacI family transcriptional regulator 3.40.50.2300 133 13 71 3.05 4.27
2qv0A00 80.81 Protein mrkEKlebsiella pneumoniae 3.40.50.2300 122 9 72 2.87 3.98
3d8uB01 80.78 Putative transcriptional regulatorVibrio parahaemolyticusLacI family transcriptional regulator, gluconate utilization system Gnt-I transcriptional repressor 3.40.50.2300 119 17 78 3.65 4.62
2kyrA00 80.58 PTS system, fructose-specific IIB-like component [EC:2.7.1.69]Escherichia coli K-12Fructose-like phosphotransferase enzyme IIB component 1 3.40.50.2300 108 14 87 4.19 4.76
3clkB01 80.07 Lactobacillus plantarumTranscription regulator 3.40.50.2300 119 8 74 3.30 4.41
1vrvA00 79.91 Phosphotransferase system (PTS)Fructose and mannose metabolismPTS system, mannitol-specific IIC componentPTS system, mannitol-specific IIA component [EC:2.7.1.69]PTS system, mannitol-specific IIB component [EC:2.7.1.69] 3.40.50.10370 96 13 88 3.73 4.21
2q5cA02 79.86 Clostridium acetobutylicumNtrC family transcriptional regulator (PAS and AAA domains) 3.40.50.10660 89 7 76 2.77 3.63
2qzjA00 79.67 Two-component response regulatorClostridium difficile 630 3.40.50.2300 119 10 76 2.63 3.44
1a04A01 79.64 Two-component systemTwo-component system, NarL family, nitrate/nitrite response regulator NarLProtein bindingEscherichia coli K-12Nitrate/nitrite response regulator protein narL 3.40.50.2300 124 13 74 2.99 4.03
3b2nA00 79.57 Similar to two-component response regulatorStaphylococcus aureus subsp. aureus Mu50 3.40.50.2300 119 13 74 2.51 3.36
2b4aA00 78.88 BH3024 proteinBacillus halodurans 3.40.50.2300 116 6 76 2.72 3.55
2qu7A01 78.68 Putative transcriptional regulatorStaphylococcus saprophyticus subsp. saprophyticus ATCC 15305 3.40.50.2300 129 17 74 3.43 4.61
2pjuA02 78.61 Positive regulation of gene-specific transcriptionPropionate catabolism operon regulatory proteinNegative regulation of gene-specific transcriptionEscherichia coli K-12Specific transcriptional repressor activity 3.40.50.10660 88 10 75 3.06 4.07
1bykA01 78.58 Specific transcriptional repressor activityLacI family transcriptional regulator, trehalose operon repressorSequence-specific DNA binding transcription factor activityTranscriptionHTH-type transcriptional regulator treR 3.40.50.2300 138 14 69 3.18 4.57
2qsjB00 78.56 DNA-binding response regulator, LuxR familyRuegeria pomeroyi 3.40.50.2300 122 10 76 3.27 4.29
1gtzA00 78.29 Phenylalanine, tyrosine and tryptophan biosynthesis3-dehydroquinate dehydratase II [EC:4.2.1.10]Streptomyces coelicolor3-dehydroquinate dehydrataseMetabolic pathways 3.40.50.9100 149 10 62 2.49 3.99
1a2oA01 77.71 Bacterial chemotaxisTwo-component systemChemotaxis response regulator protein-glutamate methylesteraseTwo-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]Salmonella enterica subsp. enterica serovar Typhimurium 3.40.50.2300 133 7 67 2.64 3.90
1edzA02 77.58 One carbon pool by folateIdentical protein bindingMethylenetetrahydrofolate dehydrogenase (NAD+) [EC:1.5.1.15]Purine base biosynthetic processMethylenetetrahydrofolate dehydrogenase (NAD+) activity 3.40.192.10 131 7 70 2.70 3.84
2c4wA00 77.26 Phenylalanine, tyrosine and tryptophan biosynthesisMetabolic pathwaysHelicobacter pylori3-dehydroquinate dehydratase II [EC:4.2.1.10]3-dehydroquinate dehydratase 3.40.50.9100 168 10 57 2.63 4.56
1z0sA01 77.08 Archaeoglobus fulgidusProbable inorganic polyphosphate/ATP-NAD kinaseNAD+ kinase [EC:2.7.1.23]Nicotinate and nicotinamide metabolismMetabolic pathways 3.40.50.10330 123 13 69 3.31 4.73
3kuuD00 76.93 Purine metabolismMetabolic pathwaysPhosphoribosylaminoimidazole carboxylase catalytic subunit PurE5-(carboxyamino)imidazole ribonucleotide mutase [EC:5.4.99.18]Yersinia pestis 3.40.50.7700 150 11 63 3.06 4.83
2ayzA00 76.80 Two-component systemTwo-component system, NarL family, capsular synthesis sensor histidine kinase RcsC [EC:2.7.13.3]Sensor kinase protein rcsCEscherichia coli K-12 3.40.50.2300 133 10 69 2.87 4.10
3cwcB01 76.59 Glycerate kinase [EC:2.7.1.31]Glycerolipid metabolismSalmonella enterica subsp. enterica serovar TyphimuriumPutative glycerate kinase 2Glycine, serine and threonine metabolism 3.40.50.10350 137 9 62 2.93 4.67
2i4rB00 76.39 Oxidative phosphorylationArchaeoglobus fulgidusV-type H+-transporting ATPase subunit F [EC:3.6.3.14]Metabolic pathwaysV-type ATP synthase subunit F 3.40.50.10580 77 7 68 3.03 4.45
1dcfA00 76.39 Response to insectResponse to abscisic acid stimulusResponse to heatResponse to gibberellin stimulusDefense response to bacterium 3.40.50.2300 133 11 69 3.19 4.61
1w25B02 76.05 Two-component systemCell cycle - CaulobacterCaulobacter vibrioidesIdentical protein bindingTwo-component system, cell cycle response regulator 3.40.50.2300 143 11 63 2.63 4.13
1qo0D01 75.97 Pseudomonas aeruginosaAliphatic amidase regulator 3.40.50.2300 127 6 70 3.11 4.44
1g7sA03 75.87 Methanothermobacter thermautotrophicus str. Delta HTranslation initiation factor IF-2 unclassified subunitProbable translation initiation factor IF-2 3.40.50.10050 81 8 71 2.70 3.80
2hqbA01 75.85 Transcriptional activator of comK geneTranscriptional activator of comK geneBacillus halodurans 3.40.50.2300 130 12 71 3.55 4.96
3kg2B01 75.73 Rattus norvegicusGlutamate receptor 2Synaptic transmissionPerikaryonDendrite cytoplasm 3.40.50.2300 161 10 57 2.73 4.73
1cvrA01 75.69 Gingipain R [EC:3.4.22.37]Porphyromonas gingivalisGingipain R2 3.40.50.10390 117 6 67 3.10 4.59
1sr8A03 75.59 Porphyrin and chlorophyll metabolismArchaeoglobus fulgidusCobalamin biosynthesis protein CbiDPutative cobalt-precorrin-6A synthase [deacetylating]Metabolic pathways 3.40.50.10720 90 4 65 3.27 4.96
1lu9A01 75.54 Methylobacterium extorquens AM1Bifunctional protein mdtA 3.40.50.10280 136 8 70 3.26 4.62
2gfqA02 75.07 Hypothetical proteinPyrococcus horikoshiiD-tyrosyl-tRNA(Tyr) deacylase 3.40.50.10700 87 13 76 3.57 4.68
3cz5B00 74.91 Two-component response regulator, LuxR familyAurantimonas manganoxydans SI85-9A1 3.40.50.2300 140 8 62 3.08 4.90
1uuyA00 74.23 Arabidopsis thalianaMolybdenum ion bindingMolybdopterin biosynthesis protein MoeAAuxin mediated signaling pathwayMolybdopterin biosynthesis protein CNX1 3.40.980.10 161 15 60 2.69 4.46
3iwtA00 74.01 178aa long hypothetical molybdenum cofactor biosynthesis protein BSulfolobus tokodaiiMolybdenum cofactor biosynthesis protein B 3.40.980.10 159 16 60 2.83 4.69
[1]
Displaying entries 1 to 39 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2q5cA01
SLSLKIALISQNENLLNLFPKLALEKNFIPITKTASLTRASKIAFGLQDEVDAIISRGATSDYIKKSVSIPSISIKSGEE
SLRRAIEEALNLIEVRN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2q5cA01
MSLSLKIALISQNENLLNLFPKLALEKNFIPITKTASLTRASKIAFGLQDEVDAIISRGATSDYIKKSVSIPSISIKSGE
ESLRRAIEEALNLIEVRNEGHHHHHH
BLAST against CATH

[top]
Domain History Events (71)

Domain assigned by cuff on 02 Apr 2008 16:44

same superfamily

Domain assignment manual match h by cuff on 02 Apr 2008 16:43

ample evidence for homology

Domain assignment manual match t by tronnberg on 20 Sep 2007 14:12

SSAP: 83.4 OV: 76 SEQ: 13. very similar linkage and structure. Functionally different. None of the matches with a assigned CATH code has the same function as the query.

Homcheck review by tronnberg on 20 Sep 2007 14:12

SSAP: 83.4 OV: 76 SEQ: 13. very similar linkage and structure. Functionally different. None of the matches with a assigned CATH code has the same function as the query.

Flow stage update by tronnberg on 20 Sep 2007 14:12

SSAP: 83.4 OV: 76 SEQ: 13. very similar linkage and structure. Functionally different. None of the matches with a assigned CATH code has the same function as the query.

Homcheck allotment by tronnberg on 20 Sep 2007 14:00

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 20 Sep 2007 14:00

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 17 Sep 2007 13:19

Domain "2q5cA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 17 Sep 2007 13:18

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2q5cA01

Flow stage update by auto on 17 Sep 2007 12:18

Retrieved PRC_PFAMCATH results for job ID SID4599711358590170 and results inserted.

Domain scan prc pfamcath by auto on 17 Sep 2007 12:17

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 3 results for 2q5cA01

Update comment by auto on 17 Sep 2007 02:52

PRC_PFAMCATH job SID4599711358590170 is not yet finished.

Prc pfamcath submit by auto on 17 Sep 2007 02:47

The entry "2q5cA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 17 Sep 2007 02:47

The entry "2q5cA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 17 Sep 2007 02:28

Retrieved SSAP results for job ID SID5770724173574816 and results inserted.

Domain scan ssap cath by auto on 17 Sep 2007 02:23

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 4257 results for 2q5cA01

Update comment by auto on 15 Sep 2007 14:28

SSAP job SID5770724173574816 is not yet finished.

Flow stage update by auto on 15 Sep 2007 14:18

The entry "2q5cA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 15 Sep 2007 14:18

The entry "2q5cA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 08:26

Giving up on SSAP job SID0040633691824333 because submission time of Sun Sep 9 22:50:53 2007 is more than 345600 seconds older than current time (Sat Sep 15 08:26:17 2007).

Update comment by auto on 09 Sep 2007 23:29

SSAP job SID0040633691824333 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:50

The entry "2q5cA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:50

The entry "2q5cA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:21

Giving up on SSAP job SID1424103747516116 because submission time of Wed Sep 5 19:00:55 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:21:38 2007).

Update comment by auto on 05 Sep 2007 20:05

SSAP job SID1424103747516116 is not yet finished.

Flow stage update by auto on 05 Sep 2007 19:00

The entry "2q5cA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 19:00

The entry "2q5cA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 14:21

Retrieved PRC results for job ID SID8342437388354160 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 14:20

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 2q5cA01

Prc cath submit by auto on 05 Sep 2007 04:36

The entry "2q5cA01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 04:36

The entry "2q5cA01" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 02:04

Retrieved HMM(SAM) results for job ID SID9027396863833552 and inserted them into the database.

Domain scan sam cath by auto on 05 Sep 2007 02:04

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2q5cA01

Update comment by auto on 04 Sep 2007 13:30

HMM(SAM) job SID9027396863833552 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:36

The entry "2q5cA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:36

The entry "2q5cA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 07:57

Retrieved "2q5cA01" CATHEDRAL results for job ID SID7834669893578272 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 07:55

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 450 results for 2q5cA01

Flow stage update by auto on 03 Sep 2007 14:37

The entry "2q5cA01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Sep 2007 14:37

The entry "2q5cA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:54

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2q5cA01.scanlist" for "2q5cA01"

Write scan list by auto on 03 Sep 2007 12:54

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2q5cA01.scanlist" for domain "2q5cA01"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:32

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:33

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:23

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:23

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:29

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:13

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:16

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:17

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:42

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:17

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:34

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:08

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:18

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:13

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:33

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:38

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:17

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:43

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:06

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 02:25

Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Flow stage update by auto on 29 Aug 2007 02:20

No satisfactory AssignClose result found.

Flow stage update by auto on 29 Aug 2007 02:09

No in_process hits for Domain "2q5cA01" ready to be processed

Flow stage update by auto on 29 Aug 2007 02:09

NW result present for Domain "2q5cA01"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2q5cA01"

Flow stage update by auto on 18 Aug 2007 14:31

Beginning processing for Domain "2q5cA01"

Insertion by cuff on 18 Aug 2007 12:35

nice chopping