Domain assigned by cuff on 03 Apr 2008 12:10
same superfamily
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|2q22A00 NLTTADAKKILNKFNCLDIAPILKPSEKESVRRALILITKLSDYQILGICADTADEGLLAKTYSHALGYEVPDLPVVEGP VYIKLNGKNGLCYLDSYAGHHRGVLVSCQSYYEGGINEYGHLPLDLFV
same superfamily
homologous
SSAP: 73.2 OV: 68 SEQ: 9. Similar overal structure. The query's function is unknown.
SSAP: 73.2 OV: 68 SEQ: 9. Similar overal structure. The query's function is unknown.
SSAP: 73.2 OV: 68 SEQ: 9. Similar overal structure. The query's function is unknown.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "2q22A00" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2q22A00
Retrieved PRC_PFAMCATH results for job ID SID6800093469298778 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2q22A00
PRC_PFAMCATH job SID6800093469298778 is not yet finished.
The entry "2q22A00" has been submitted to the PRC_PFAMCATH webservice.
The entry "2q22A00" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID9625565744536736 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2337 results for 2q22A00
SSAP job SID9625565744536736 is not yet finished.
The entry "2q22A00" has been submitted to the SSAP webservice.
The entry "2q22A00" has been submitted to the SSAP webservice.
Giving up on SSAP job SID0538057877599312 because submission time of Sun Sep 9 22:50:25 2007 is more than 345600 seconds older than current time (Sat Sep 15 08:25:54 2007).
SSAP job SID0538057877599312 is not yet finished.
The entry "2q22A00" has been submitted to the SSAP webservice.
The entry "2q22A00" has been submitted to the SSAP webservice.
Giving up on SSAP job SID0588000712729536 because submission time of Wed Sep 5 19:00:28 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:21:11 2007).
SSAP job SID0588000712729536 is not yet finished.
The entry "2q22A00" has been submitted to the SSAP webservice.
The entry "2q22A00" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID0573067244546896 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2q22A00
The entry "2q22A00" has been submitted to the PRC webservice.
The entry "2q22A00" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID0542750909381472 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2q22A00
HMM(SAM) job SID0542750909381472 is not yet finished.
The entry "2q22A00" has been submitted to the HMM (SAM) webservice.
The entry "2q22A00" has been submitted to the HMM (SAM) webservice.
Retrieved "2q22A00" CATHEDRAL results for job ID SID8431635015731248 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 81 results for 2q22A00
The entry "2q22A00" has been submitted to the CATHEDRAL webservice.
The entry "2q22A00" has been submitted to the CATHEDRAL webservice.
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2q22A00.scanlist" for "2q22A00"
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2q22A00.scanlist" for domain "2q22A00"
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "2q22A00" ready to be processed
NW result present for Domain "2q22A00"
All required files are present for Domain "2q22A00"
Beginning processing for Domain "2q22A00"
nice chopping