Domain assigned by cuff on 03 Apr 2008 12:10
same superfamily
CATH Domain: 2q22A00
2q22A00
PDB 2q22, Chain A, Domain 0
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2q22A00 NLTTADAKKILNKFNCLDIAPILKPSEKESVRRALILITKLSDYQILGICADTADEGLLAKTYSHALGYEVPDLPVVEGP VYIKLNGKNGLCYLDSYAGHHRGVLVSCQSYYEGGINEYGHLPLDLFV
Domain History Events (71)
Domain assignment manual match h by cuff on 03 Apr 2008 12:06
homologous
Domain assignment manual match a by tronnberg on 20 Sep 2007 13:53
SSAP: 73.2 OV: 68 SEQ: 9. Similar overal structure. The query's function is unknown.
Homcheck review by tronnberg on 20 Sep 2007 13:53
SSAP: 73.2 OV: 68 SEQ: 9. Similar overal structure. The query's function is unknown.
Flow stage update by tronnberg on 20 Sep 2007 13:53
SSAP: 73.2 OV: 68 SEQ: 9. Similar overal structure. The query's function is unknown.
Homcheck allotment by tronnberg on 20 Sep 2007 13:51
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 20 Sep 2007 13:51
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 17 Sep 2007 13:16
Domain "2q22A00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 17 Sep 2007 13:15
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2q22A00
Flow stage update by auto on 17 Sep 2007 12:13
Retrieved PRC_PFAMCATH results for job ID SID6800093469298778 and results inserted.
Domain scan prc pfamcath by auto on 17 Sep 2007 12:12
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2q22A00
Update comment by auto on 17 Sep 2007 02:51
PRC_PFAMCATH job SID6800093469298778 is not yet finished.
Flow stage update by auto on 17 Sep 2007 02:47
The entry "2q22A00" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 17 Sep 2007 02:47
The entry "2q22A00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 17 Sep 2007 02:21
Retrieved SSAP results for job ID SID9625565744536736 and results inserted.
Domain scan ssap cath by auto on 17 Sep 2007 02:17
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2337 results for 2q22A00
Update comment by auto on 15 Sep 2007 14:27
SSAP job SID9625565744536736 is not yet finished.
Flow stage update by auto on 15 Sep 2007 14:18
The entry "2q22A00" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 15 Sep 2007 14:18
The entry "2q22A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 15 Sep 2007 08:25
Giving up on SSAP job SID0538057877599312 because submission time of Sun Sep 9 22:50:25 2007 is more than 345600 seconds older than current time (Sat Sep 15 08:25:54 2007).
Update comment by auto on 09 Sep 2007 23:28
SSAP job SID0538057877599312 is not yet finished.
Ssap cath submit by auto on 09 Sep 2007 22:50
The entry "2q22A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 22:50
The entry "2q22A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 09 Sep 2007 20:21
Giving up on SSAP job SID0588000712729536 because submission time of Wed Sep 5 19:00:28 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:21:11 2007).
Update comment by auto on 05 Sep 2007 20:04
SSAP job SID0588000712729536 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 19:00
The entry "2q22A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 19:00
The entry "2q22A00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 14:16
Retrieved PRC results for job ID SID0573067244546896 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 14:15
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2q22A00
Flow stage update by auto on 05 Sep 2007 04:35
The entry "2q22A00" has been submitted to the PRC webservice.
Prc cath submit by auto on 05 Sep 2007 04:35
The entry "2q22A00" has been submitted to the PRC webservice.
Flow stage update by auto on 05 Sep 2007 02:00
Retrieved HMM(SAM) results for job ID SID0542750909381472 and inserted them into the database.
Domain scan sam cath by auto on 05 Sep 2007 02:00
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2q22A00
Update comment by auto on 04 Sep 2007 13:29
HMM(SAM) job SID0542750909381472 is not yet finished.
Sam cath submit by auto on 04 Sep 2007 10:35
The entry "2q22A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 10:35
The entry "2q22A00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 07:51
Retrieved "2q22A00" CATHEDRAL results for job ID SID8431635015731248 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Sep 2007 07:50
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 81 results for 2q22A00
Flow stage update by auto on 03 Sep 2007 14:36
The entry "2q22A00" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 03 Sep 2007 14:36
The entry "2q22A00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 12:54
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2q22A00.scanlist" for "2q22A00"
Write scan list by auto on 03 Sep 2007 12:54
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2q22A00.scanlist" for domain "2q22A00"
Update comment by auto on 03 Sep 2007 10:11
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:32
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:37
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:33
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:23
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:23
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:16
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:29
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:13
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:16
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:17
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:42
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:17
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:34
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:08
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 16:18
Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 10:13
Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 06:33
Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 02:38
Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 22:17
Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 14:43
Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 09:06
Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 02:25
Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Flow stage update by auto on 29 Aug 2007 02:20
No satisfactory AssignClose result found.
Flow stage update by auto on 29 Aug 2007 02:09
No in_process hits for Domain "2q22A00" ready to be processed
Flow stage update by auto on 29 Aug 2007 02:09
NW result present for Domain "2q22A00"
Flow stage update by auto on 19 Aug 2007 10:12
All required files are present for Domain "2q22A00"
Flow stage update by auto on 18 Aug 2007 14:31
Beginning processing for Domain "2q22A00"
Insertion by cuff on 18 Aug 2007 12:35
nice chopping
