CATH Domain: 2q14B01 XML data for domain: 2q14B01

Molscript image for 2q14B01
2q14B01
PDB coordinates for domain 2q14B01

PDB 2q14, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.3210 Hypothetical protein af1432
1.10.3210.10 Hypothetical protein af1432 Gene3D
1.10.3210.10.8
1.10.3210.10.8.1
1.10.3210.10.8.1.1
1.10.3210.10.8.1.1.1
1.10.3210.10.8.1.1.1.1

[top]
Segment boundaries for domain 2q14B01

Chopping figure for domain 2q14B01
DomainStart PDB ResidueStop PDB Residue
2q14B01 5 99
2q14B01 115 220
2q14B01 363 394
2q14B02 100 114
2q14B02 221 362
2q14B02 395 407

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2q14B01
RKIINDPVFGFINIPKGLLYDIVRHPLLQRLTRIKQVGLSSVVYPGAQHTRFQHSLGAFYLSEAITQLTSKGNFIFDSEA
EAVQAAILLHDIGHSHEEISLLERNKENGQLSLAIQIFKDEYPKRFLHQLVSGQLDDRLDYLRRDSFYTGVTEGNIGSAR
IIKLDVADDRLVIESKGIYSIENFLTARRLYWQDPADDSIDIIYKDGTIKNIAEASDLNISLLS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2q14B01
GXPYERKIINDPVFGFINIPKGLLYDIVRHPLLQRLTRIKQVGLSSVVYPGAQHTRFQHSLGAFYLXSEAITQLTSKGNF
IFDSEAEAVQAAILLHDIGHSHEEISLXLXERXNKEXNGQLSLAIQIFKDEYPKRFLHQLVSGQLDXDRLDYLRRDSFYT
GVTEGNIGSARIIKXLDVADDRLVIESKGIYSIENFLTARRLXYWQDPADDSIDIIYKDGTIKNIAEASDXLNISLLS
BLAST against CATH

[top]
Domain History Events (15)

Domain assigned by auto on 15 Apr 2008 20:29

Assigning to "1.10.3210.10" based on similarity with "2q14H01"

Flow stage update by auto on 15 Apr 2008 20:27

No in_process hits for Domain "2q14B01" ready to be processed

Update comment by auto on 15 Apr 2008 20:26

Domain "2q14B01" hits Domain "2q14E01" (95.7983193277311% over 98.7551867219917%) which is currently in process

Update comment by auto on 15 Apr 2008 20:24

Domain "2q14B01" hits Domain "2q14F01" (95.7983193277311% over 100%) which is currently in process

Update comment by auto on 15 Apr 2008 20:22

Domain "2q14B01" hits Domain "2q14A01" (95.7983193277311% over 98.7551867219917%) which is currently in process

Update comment by auto on 15 Apr 2008 20:17

Domain "2q14B01" hits Domain "2q14H01" (95.7983193277311% over 100%) which is currently in process

Update comment by auto on 15 Apr 2008 20:06

Domain "2q14B01" hits Domain "2q14G01" (95.7983193277311% over 98.7551867219917%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "2q14B01" hits Domain "2q14C01" (95.7983193277311% over 98.7551867219917%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2q14B01" hits Domain "2q14C01" (95.7983193277311% over 98.7551867219917%) which is currently in process

Update comment by auto on 28 Aug 2007 22:06

Domain "2q14B01" hits Domain "2q14C01" (95.7983193277311% over 98.7551867219917%) which is currently in process

Flow stage update by auto on 28 Aug 2007 22:05

Domain "2q14B01" hits Domain "2q14C01" (95.7983193277311% over 98.7551867219917%) which is currently in process

Flow stage update by auto on 28 Aug 2007 22:05

NW result present for Domain "2q14B01"

Flow stage update by auto on 21 Aug 2007 10:06

All required files are present for Domain "2q14B01"

Flow stage update by auto on 20 Aug 2007 17:33

Beginning processing for Domain "2q14B01"

Insertion by auto on 20 Aug 2007 14:36

Final ChopClose added based on similarity with "2q14A"