CATH Domain: 2q0zX02 XML data for domain: 2q0zX02

Molscript image for 2q0zX02
2q0zX02
PDB coordinates for domain 2q0zX02

PDB 2q0z, Chain X, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.150 DNA polymerase; domain 1
1.10.150.20 5' to 3' exonuclease, C-terminal subdomain Gene3D
1.10.150.20.19
1.10.150.20.19.1
1.10.150.20.19.1.1
1.10.150.20.19.1.1.1
1.10.150.20.19.1.1.1.1

[top]
Segment boundaries for domain 2q0zX02

Chopping figure for domain 2q0zX02
DomainStart PDB ResidueStop PDB Residue
2q0zX01 33 149
2q0zX02 150 207
2q0zX03 208 322

Structural Neighbourhood (17 entries)

There are 17 matching structural neighberhood comparisons for CATH ID 1.10.150.20.19.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 17 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1wcnA01 84.74 N utilization substance protein ATranscription elongation protein nusAEscherichia coli K-12 1.10.150.20 60 14 93 2.63 2.82
2dflA01 82.93 DNA repair and recombination protein radASulfolobus solfataricusDNA repair protein RadA 1.10.150.20 60 10 90 2.71 3.01
1dxsA00 81.49 DNA damage response, signal transduction resulting in induction of apoptosisTranscription factor bindingProtein bindingPositive regulation of transcription, DNA-dependentMismatch repair 1.10.150.50 57 14 87 2.80 3.19
1szpA01 81.43 DNA repair protein RAD51Identical protein bindingDouble-strand break repair via homologous recombinationHeteroduplex formationDNA-dependent ATPase activity 1.10.150.20 72 8 77 3.28 4.22
1z1vA00 80.04 Protein kinase regulator activitySAM domain bindingProtein STE50Signal transduction involved in filamentous growthPheromone-dependent signal transduction involved in conjugation with cellular fusion 1.10.150.50 70 7 78 2.84 3.61
3h8mA00 79.96 EphA7 [EC:2.7.10.1]Homo sapiensEphrin type-A receptor 7Axon guidance 1.10.150.50 71 12 76 2.67 3.51
1ci4A00 79.42 Barrier-to-autointegration factorHomo sapiensResponse to virus 1.10.150.40 87 10 64 2.72 4.23
1dgsA05 78.92 DNA ligaseThermus filiformis 1.10.150.20 69 19 81 3.27 4.03
1x9xA00 78.39 MAPK signaling pathway - yeastSAM domain bindingIdentical protein bindingInvasive growth in response to glucose limitationActivation of MAPKK activity 1.10.150.50 62 10 87 3.38 3.88
1v38A00 78.05 Mus musculusSAM domain-containing protein SAMSN-1 1.10.150.50 78 10 71 3.26 4.54
3kkaD00 77.82 Integral to plasma membraneEphrin type-A receptor 2Protein bindingSignal transductionEph receptor A2 [EC:2.7.10.1] 1.10.150.50 68 8 77 2.69 3.45
1lb2B00 76.17 Pyrimidine metabolismPurine metabolismRNA polymeraseMetabolic pathwaysDNA-directed RNA polymerase subunit alpha [EC:2.7.7.6] 1.10.150.20 72 7 70 3.44 4.86
1b4fA00 76.16 Ephrin type-B receptor 2Homo sapiensTransmembrane-ephrin receptor activity 1.10.150.50 74 7 67 3.10 4.59
1pk3A00 75.59 PRC1 complexIdentical protein bindingNegative regulation of transcriptionPolycomb protein ScmAxonogenesis 1.10.150.50 76 3 68 2.66 3.89
1oxjA01 75.16 Cytoplasmic mRNA processing bodyNuclear-transcribed mRNA poly(A) tail shorteningEstablishment of RNA localizationProtein SmaugDrosophila melanogaster 1.10.150.50 61 14 83 4.06 4.86
1bvsA02 74.50 Homologous recombinationHolliday junction ATP-dependent DNA helicase ruvAMycobacterium lepraeHolliday junction DNA helicase RuvA 1.10.150.20 70 5 74 3.70 4.98
1x66A01 74.20 Sequence-specific DNA binding transcription factor activityHemostasisOrgan morphogenesisHomo sapiensFriend leukemia integration 1 transcription factor 1.10.150.50 70 5 70 3.23 4.61
[1]
Displaying entries 1 to 17 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2q0zX02
DSYLKQLPHFTSEHIKRCTDKGVESVFDIEEDEERNALLQLTDSQIADVARFCNRY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2q0zX02
DSYLKQLPHFTSEHIKRCTDKGVESVFDIXEXEDEERNALLQLTDSQIADVARFCNRY
BLAST against CATH

[top]
Domain History Events (72)

Domain assigned by cuff on 19 Mar 2008 14:12

same superfamily

Domain assignment manual match h by cuff on 19 Mar 2008 14:06

ample evidence for homology

Domain assignment manual match t by tronnberg on 20 Sep 2007 13:00

SSAP: 84.1 OV: 82 SEQ: 8. Similar linkage and structure. Functionally different.

Homcheck review by tronnberg on 20 Sep 2007 13:00

SSAP: 84.1 OV: 82 SEQ: 8. Similar linkage and structure. Functionally different.

Flow stage update by tronnberg on 20 Sep 2007 13:00

SSAP: 84.1 OV: 82 SEQ: 8. Similar linkage and structure. Functionally different.

Homcheck allotment by tronnberg on 20 Sep 2007 12:56

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 20 Sep 2007 12:56

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 17 Sep 2007 13:13

Domain "2q0zX02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 17 Sep 2007 13:12

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2q0zX02

Flow stage update by auto on 17 Sep 2007 12:10

Retrieved PRC_PFAMCATH results for job ID SID3612846907993472 and results inserted.

Domain scan prc pfamcath by auto on 17 Sep 2007 12:09

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 9 results for 2q0zX02

Update comment by auto on 16 Sep 2007 14:41

PRC_PFAMCATH job SID3612846907993472 is not yet finished.

Prc pfamcath submit by auto on 16 Sep 2007 14:39

The entry "2q0zX02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 16 Sep 2007 14:39

The entry "2q0zX02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 16 Sep 2007 14:33

Retrieved SSAP results for job ID SID9452197808477984 and results inserted.

Domain scan ssap cath by auto on 16 Sep 2007 14:30

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1894 results for 2q0zX02

Update comment by auto on 15 Sep 2007 14:27

SSAP job SID9452197808477984 is not yet finished.

Ssap cath submit by auto on 15 Sep 2007 14:17

The entry "2q0zX02" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 14:17

The entry "2q0zX02" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 08:25

Giving up on SSAP job SID0767437718890720 because submission time of Sun Sep 9 22:50:05 2007 is more than 345600 seconds older than current time (Sat Sep 15 08:25:35 2007).

Update comment by auto on 09 Sep 2007 23:28

SSAP job SID0767437718890720 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:50

The entry "2q0zX02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:50

The entry "2q0zX02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:20

Giving up on SSAP job SID2494183364774288 because submission time of Wed Sep 5 19:00:06 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:20:50 2007).

Update comment by auto on 05 Sep 2007 20:04

SSAP job SID2494183364774288 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 19:00

The entry "2q0zX02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 19:00

The entry "2q0zX02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 14:12

Retrieved PRC results for job ID SID8210992133409024 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 14:12

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2q0zX02

Prc cath submit by auto on 05 Sep 2007 04:35

The entry "2q0zX02" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 04:35

The entry "2q0zX02" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 01:58

Retrieved HMM(SAM) results for job ID SID7168515154994304 and inserted them into the database.

Domain scan sam cath by auto on 05 Sep 2007 01:57

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2q0zX02

Update comment by auto on 04 Sep 2007 13:29

HMM(SAM) job SID7168515154994304 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:35

The entry "2q0zX02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:35

The entry "2q0zX02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 07:48

Retrieved "2q0zX02" CATHEDRAL results for job ID SID5191700926979608 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 07:46

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 169 results for 2q0zX02

Cathedral cath submit by auto on 03 Sep 2007 14:36

The entry "2q0zX02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:36

The entry "2q0zX02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:53

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2q0zX02.scanlist" for "2q0zX02"

Write scan list by auto on 03 Sep 2007 12:53

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2q0zX02.scanlist" for domain "2q0zX02"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:32

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:33

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:23

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:23

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:29

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:13

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:16

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:17

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:42

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:17

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:34

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:08

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:18

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:13

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:33

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:38

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:17

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:43

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:06

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 02:24

Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 22:30

Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Flow stage update by auto on 28 Aug 2007 22:13

No satisfactory AssignClose result found.

Flow stage update by auto on 28 Aug 2007 22:05

No in_process hits for Domain "2q0zX02" ready to be processed

Flow stage update by auto on 28 Aug 2007 22:05

NW result present for Domain "2q0zX02"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2q0zX02"

Flow stage update by auto on 18 Aug 2007 14:31

Beginning processing for Domain "2q0zX02"

Insertion by cuff on 18 Aug 2007 14:00

nice chopping