CATH Domain: 2q0uA01 XML data for domain: 2q0uA01

Molscript image for 2q0uA01
2q0uA01
PDB coordinates for domain 2q0uA01

PDB 2q0u, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.40 Gene3D
3.30.420.40.3
3.30.420.40.3.1
3.30.420.40.3.1.1
3.30.420.40.3.1.1.1
3.30.420.40.3.1.1.1.1

[top]
Segment boundaries for domain 2q0uA01

Chopping figure for domain 2q0uA01
DomainStart PDB ResidueStop PDB Residue
2q0uA01 7 137
2q0uA01 339 374
2q0uA02 138 179
2q0uA02 272 338
2q0uA03 180 271

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.30.420.40.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1jceA01 83.89 Thermotoga maritimaRod shape-determining protein MreB and related proteinsRod shape-determining protein MreB 3.30.420.40 147 10 83 2.54 3.05
1e4fT03 78.24 Thermotoga maritimaCell division protein FtsA, putativeCell division protein FtsA 3.30.420.40 136 8 62 2.91 4.66
2d0oA01 76.13 Klebsiella oxytocaDiol dehydratase-reactivating factor large subunit 3.30.420.40 135 8 64 2.84 4.41
3h1qA01 75.83 Ethanolamine utilization protein EutJCarboxydothermus hydrogenoformans Z-2901Ethanolamine utilization protein EutJ 3.30.420.40 152 6 65 3.18 4.88
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2q0uA01
ALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPDSYVGDEAQSKTLKYPIEGIITNWDDMEKIWHHTFYNELRVAPEEHPT
LLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKC
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2q0uA01
DEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEXGIITNWD
DMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQVWIGGSILASLSTFQQMWITKQE
YDEAGPSIVHRKCF
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 28 Aug 2007 22:15

Assigning to "3.30.420.40" based on similarity with "2q36A01"

Flow stage update by auto on 28 Aug 2007 22:15

No in_process hits for Domain "2q0uA01" ready to be processed

Update comment by auto on 28 Aug 2007 22:12

Domain "2q0uA01" hits Domain "2q0rA01" (99.4252873563218% over 100%) which is currently in process

Flow stage update by auto on 28 Aug 2007 22:05

Domain "2q0uA01" hits Domain "2q0rA01" (99.4252873563218% over 100%) which is currently in process

Flow stage update by auto on 28 Aug 2007 22:05

NW result present for Domain "2q0uA01"

Flow stage update by auto on 19 Aug 2007 10:13

All required files are present for Domain "2q0uA01"

Flow stage update by auto on 16 Aug 2007 17:14

Beginning processing for Domain "2q0uA01"

Insertion by auto on 16 Aug 2007 10:39

Final ChopClose added based on similarity with "1wuaA"