CATH Domain: 2q0tB01 XML data for domain: 2q0tB01

Molscript image for 2q0tB01
2q0tB01
PDB coordinates for domain 2q0tB01

PDB 2q0t, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1290 AhpD-like
1.20.1290.10 AhpD-like Gene3D
1.20.1290.10.9
1.20.1290.10.9.1
1.20.1290.10.9.1.1
1.20.1290.10.9.1.1.1
1.20.1290.10.9.1.1.1.1

[top]
Segment boundaries for domain 2q0tB01

Chopping figure for domain 2q0tB01
DomainStart PDB ResidueStop PDB Residue
2q0tB01 9 254

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2q0tB01
DPSRLRDELVRLHGKASPEWDSLVRLDPRFVDAYLKFAGVPQRRNHLDDKTRAFIALAADACATQLYAPGVARHIERALS
FGATREELIEVLELVSTIGIHTSNVGVPVLLEVLEEEGLRKGAPPLDERRQKLKAEFETNRGYWHPTWEGLLELDPDLFE
AYVEFSSVPWRTGVLSPKIKEFYCAFDASATHLYVPGLKLHIRNALRYGATAEELELLEIVSVTGIHGAELGAPLLEAAL
KRSG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2q0tB01
DPSRLRDELVRLHGKASPEWDSLVRLDPRFVDAYLKFAGVPQRRNHLDDKTRAFIALAADACATQLYAPGVARHIERALS
FGATREELIEVLELVSTIGIHTSNVGVPVLLEVLEEEGLRKGAPPLDERRQKLKAEFETNRGYWHPTWEGLLELDPDLFE
AYVEFSSVPWRTGVLSPKIKEFXYCAFDASATHLYVPGLKLHIRNALRYGATAEELXELLEIVSVTGIHGAELGAPLLEA
ALKRSGAAAGEPHA
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 14 Apr 2008 11:16

Assigning to "1.20.1290.10" based on similarity with "2q0tA01"

Flow stage update by auto on 14 Apr 2008 11:15

No in_process hits for Domain "2q0tB01" ready to be processed

Update comment by auto on 14 Apr 2008 11:05

Domain "2q0tB01" hits Domain "2q0tC01" (99.2125984251968% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "2q0tB01" hits Domain "2q0tA01" (99.2125984251968% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2q0tB01" hits Domain "2q0tA01" (99.2125984251968% over 100%) which is currently in process

Update comment by auto on 01 Sep 2007 22:04

Domain "2q0tB01" hits Domain "2q0tA01" (99.2125984251968% over 100%) which is currently in process

Flow stage update by auto on 01 Sep 2007 22:03

Domain "2q0tB01" hits Domain "2q0tA01" (99.2125984251968% over 100%) which is currently in process

Flow stage update by auto on 01 Sep 2007 22:03

NW result present for Domain "2q0tB01"

Flow stage update by auto on 25 Aug 2007 10:04

All required files are present for Domain "2q0tB01"

Flow stage update by auto on 24 Aug 2007 18:10

Beginning processing for Domain "2q0tB01"

Insertion by auto on 24 Aug 2007 18:05

Final ChopClose added based on similarity with "2q0tA"