CATH Domain: 2q07A02 XML data for domain: 2q07A02

Molscript image for 2q07A02
2q07A02
PDB coordinates for domain 2q07A02

PDB 2q07, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.90 Gene3D
3.10.450.90.2
3.10.450.90.2.1
3.10.450.90.2.1.1
3.10.450.90.2.1.1.1
3.10.450.90.2.1.1.1.1

Segment boundaries for domain 2q07A02

Chopping figure for domain 2q07A02
DomainStart PDB ResidueStop PDB Residue
2q07A01 244 394
2q07A02 395 459
2q07A03 460 527

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.10.450.90.2.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1q7hA01 79.66 PUA domain proteinThermoplasma acidophilumPutative uncharacterized protein Ta1423 3.10.450.120 63 15 84 3.44 4.09
Displaying entries 1 to 1 (page 1 of 1)


Domain ATOM Sequence

>pdb|2q07A02
VDLYRRILEHLSYQFGITWSGKVAGRYPELELLEGKKRLARVDRIYGLDIYEKIAAYLLEKNI    

Domain COMBS Sequence

>pdb|2q07A02
VDLYRRILEHXLSYQFGITWSGKVAGRYPELELLEGKKRLARVDRIYGXLDIYEKIAAYLLEKNI    

Domain History Events (72)

Domain assigned by cuff on 18 Feb 2008 10:47

same superfamily

Domain assignment manual match h by cuff on 18 Feb 2008 10:46

same superfamily

Domain assignment manual match t by tronnberg on 20 Sep 2007 12:44

SSAP: 83.0 OV: 85 SEQ: 23. Similar linkage and structure (only differ with one small alfa helix). The query's function is unknown.

Homcheck review by tronnberg on 20 Sep 2007 12:44

SSAP: 83.0 OV: 85 SEQ: 23. Similar linkage and structure (only differ with one small alfa helix). The query's function is unknown.

Flow stage update by tronnberg on 20 Sep 2007 12:44

SSAP: 83.0 OV: 85 SEQ: 23. Similar linkage and structure (only differ with one small alfa helix). The query's function is unknown.

Homcheck allotment by tronnberg on 20 Sep 2007 12:42

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 20 Sep 2007 12:42

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 17 Sep 2007 13:09

Domain "2q07A02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 17 Sep 2007 13:08

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2q07A02

Flow stage update by auto on 17 Sep 2007 12:06

Retrieved PRC_PFAMCATH results for job ID SID9782242730151616 and results inserted.

Domain scan prc pfamcath by auto on 17 Sep 2007 12:04

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2q07A02

Update comment by auto on 16 Sep 2007 06:29

PRC_PFAMCATH job SID9782242730151616 is not yet finished.

Prc pfamcath submit by auto on 16 Sep 2007 06:29

The entry "2q07A02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 16 Sep 2007 06:29

The entry "2q07A02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 16 Sep 2007 06:23

Retrieved SSAP results for job ID SID2348546109356352 and results inserted.

Domain scan ssap cath by auto on 16 Sep 2007 06:20

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2093 results for 2q07A02

Update comment by auto on 15 Sep 2007 14:27

SSAP job SID2348546109356352 is not yet finished.

Ssap cath submit by auto on 15 Sep 2007 14:17

The entry "2q07A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 14:17

The entry "2q07A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 08:24

Giving up on SSAP job SID9408132304343580 because submission time of Sun Sep 9 22:49:10 2007 is more than 345600 seconds older than current time (Sat Sep 15 08:24:47 2007).

Update comment by auto on 09 Sep 2007 23:27

SSAP job SID9408132304343580 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:49

The entry "2q07A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:49

The entry "2q07A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:19

Giving up on SSAP job SID6469132968498840 because submission time of Wed Sep 5 18:59:10 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:19:55 2007).

Update comment by auto on 05 Sep 2007 20:03

SSAP job SID6469132968498840 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 18:59

The entry "2q07A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 18:59

The entry "2q07A02" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 14:04

Retrieved PRC results for job ID SID7187062307638016 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 14:03

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 2q07A02

Flow stage update by auto on 05 Sep 2007 04:33

The entry "2q07A02" has been submitted to the PRC webservice.

Prc cath submit by auto on 05 Sep 2007 04:33

The entry "2q07A02" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 01:49

Retrieved HMM(SAM) results for job ID SID1115580945493648 and inserted them into the database.

Domain scan sam cath by auto on 05 Sep 2007 01:49

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2q07A02

Update comment by auto on 04 Sep 2007 13:28

HMM(SAM) job SID1115580945493648 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:34

The entry "2q07A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:34

The entry "2q07A02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 07:34

Retrieved "2q07A02" CATHEDRAL results for job ID SID8267639399305664 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 07:33

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 75 results for 2q07A02

Cathedral cath submit by auto on 03 Sep 2007 14:35

The entry "2q07A02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:35

The entry "2q07A02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:52

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2q07A02.scanlist" for "2q07A02"

Write scan list by auto on 03 Sep 2007 12:52

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2q07A02.scanlist" for domain "2q07A02"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:32

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:33

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:23

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:23

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:29

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:13

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:16

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 14:17

Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 11:42

Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 06:17

Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 03:34

Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Aug 2007 20:08

Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 16:18

Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 10:13

Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 06:33

Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Aug 2007 02:38

Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 22:17

Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 14:43

Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 09:06

Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Aug 2007 02:24

Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Aug 2007 22:30

Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.

Flow stage update by auto on 28 Aug 2007 22:12

No satisfactory AssignClose result found.

Flow stage update by auto on 28 Aug 2007 22:05

No in_process hits for Domain "2q07A02" ready to be processed

Flow stage update by auto on 28 Aug 2007 22:05

NW result present for Domain "2q07A02"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "2q07A02"

Flow stage update by auto on 18 Aug 2007 14:31

Beginning processing for Domain "2q07A02"

Insertion by cuff on 18 Aug 2007 14:00

nice chopping