CATH Domain: 2py5A05 XML data for domain: 2py5A05

Molscript image for 2py5A05
2py5A05
PDB coordinates for domain 2py5A05

PDB 2py5, Chain A, Domain 5

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.80 Rhinovirus 14, subunit 4
4.10.80.20 DNA polymerase; domain 5 Gene3D
4.10.80.20.1
4.10.80.20.1.1
4.10.80.20.1.1.1
4.10.80.20.1.1.1.1
4.10.80.20.1.1.1.1.1

[top]
Segment boundaries for domain 2py5A05

Chopping figure for domain 2py5A05
DomainStart PDB ResidueStop PDB Residue
2py5A01 5 188
2py5A02 189 261
2py5A02 426 531
2py5A03 262 359
2py5A04 360 395
2py5A05 396 425
2py5A06 532 575

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 4.10.80.20.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2pw9A01 79.23 FdhD proteinDesulfotalea psychrophilaRelated to formate dehydrogenase accessory protein 4.10.80.30 25 12 76 3.04 3.97
1kf6A04 79.03 Metabolic pathwaysButanoate metabolismBenzoate degradation via CoA ligationOxidative phosphorylationTwo-component system 4.10.80.40 35 3 85 3.86 4.50
2r7fA03 78.19 Exoribonuclease II [EC:3.1.13.1]Ribonuclease II family proteinDeinococcus radiodurans 4.10.80.30 21 0 70 2.58 3.69
2py5A06 74.25 DNA polymeraseBacillus phage phi29 4.10.80.30 43 6 60 2.92 4.83
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2py5A05
NPDVTGKVPYLKENGALGFRLGEEETKDPV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2py5A05
NPDVTGKVPYLKENGALGFRLGEEETKDPV
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 28 Aug 2007 18:31

Assigning to "4.10.80.20" based on similarity with "1xhxA05"

Flow stage update by auto on 28 Aug 2007 18:20

No in_process hits for Domain "2py5A05" ready to be processed

Flow stage update by auto on 28 Aug 2007 18:20

NW result present for Domain "2py5A05"

Flow stage update by auto on 19 Aug 2007 10:13

All required files are present for Domain "2py5A05"

Flow stage update by auto on 16 Aug 2007 17:14

Beginning processing for Domain "2py5A05"

Insertion by auto on 16 Aug 2007 10:19

Final ChopClose added based on similarity with "1xhxA"