CATH Domain: 2py5A03 XML data for domain: 2py5A03

Molscript image for 2py5A03
2py5A03
PDB coordinates for domain 2py5A03

PDB 2py5, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1770 TPR 1 domain of DNA polymerase
3.30.1770.10 TPR 1 domain of DNA polymerase Gene3D
3.30.1770.10.1
3.30.1770.10.1.1
3.30.1770.10.1.1.1
3.30.1770.10.1.1.1.1
3.30.1770.10.1.1.1.1.1

[top]
Segment boundaries for domain 2py5A03

Chopping figure for domain 2py5A03
DomainStart PDB ResidueStop PDB Residue
2py5A01 5 188
2py5A02 189 261
2py5A02 426 531
2py5A03 262 359
2py5A04 360 395
2py5A05 396 425
2py5A06 532 575

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2py5A03
LLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYI
SGLKFKATTGL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2py5A03
LLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYD
LYNVEYISGLKFKATTGL
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 28 Aug 2007 18:30

Assigning to "3.30.1770.10" based on similarity with "1xhxA03"

Flow stage update by auto on 28 Aug 2007 18:20

No in_process hits for Domain "2py5A03" ready to be processed

Flow stage update by auto on 28 Aug 2007 18:20

NW result present for Domain "2py5A03"

Flow stage update by auto on 19 Aug 2007 10:13

All required files are present for Domain "2py5A03"

Flow stage update by auto on 16 Aug 2007 17:14

Beginning processing for Domain "2py5A03"

Insertion by auto on 16 Aug 2007 10:19

Final ChopClose added based on similarity with "1xhxA"