CATH Domain: 2py5A01 XML data for domain: 2py5A01

Molscript image for 2py5A01
2py5A01
PDB coordinates for domain 2py5A01

PDB 2py5, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.10 Gene3D
3.30.420.10.6
3.30.420.10.6.1
3.30.420.10.6.1.1
3.30.420.10.6.1.1.1
3.30.420.10.6.1.1.1.1

[top]
Segment boundaries for domain 2py5A01

Chopping figure for domain 2py5A01
DomainStart PDB ResidueStop PDB Residue
2py5A01 5 188
2py5A02 189 261
2py5A02 426 531
2py5A03 262 359
2py5A04 360 395
2py5A05 396 425
2py5A06 532 575

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.420.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2qxfA01 77.79 Mismatch repairExodeoxyribonuclease I [EC:3.1.11.1]Exodeoxyribonuclease IExodeoxyribonuclease I activityDNA catabolic process 3.30.420.10 192 8 68 3.15 4.62
2p1jA01 75.08 Thermotoga maritimaPyrimidine metabolismDNA replicationPurine metabolismMetabolic pathways 3.30.420.10 138 13 53 2.47 4.66
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2py5A01
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSAD
GLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYA
YIKNDIQIIAEALLIQFKQGLDRM
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2py5A01
MKHMPRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFK
WSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITP
EEYAYIKNDIQIIAEALLIQFKQGLDRM
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 28 Aug 2007 18:30

Assigning to "3.30.420.10" based on similarity with "1xhxA01"

Flow stage update by auto on 28 Aug 2007 18:20

No in_process hits for Domain "2py5A01" ready to be processed

Flow stage update by auto on 28 Aug 2007 18:20

NW result present for Domain "2py5A01"

Flow stage update by auto on 19 Aug 2007 10:13

All required files are present for Domain "2py5A01"

Flow stage update by auto on 16 Aug 2007 17:14

Beginning processing for Domain "2py5A01"

Insertion by auto on 16 Aug 2007 10:19

Final ChopClose added based on similarity with "1xhxA"