CATH Domain: 2px6A02 XML data for domain: 2px6A02

Molscript image for 2px6A02
2px6A02
PDB coordinates for domain 2px6A02

PDB 2px6, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1470 Protein Yjbj; Chain: A;
1.10.1470.20 Fatty acid synthase; domain 2 Gene3D
1.10.1470.20.1
1.10.1470.20.1.1
1.10.1470.20.1.1.1
1.10.1470.20.1.1.1.1
1.10.1470.20.1.1.1.1.1

[top]
Segment boundaries for domain 2px6A02

Chopping figure for domain 2px6A02
DomainStart PDB ResidueStop PDB Residue
2px6A01 2221 2342
2px6A01 2433 2501
2px6A02 2343 2432

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 1.10.1470.20.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2hszA02 82.90 Phosphoglycolate phosphatase [EC:3.1.3.18]Haemophilus somnus 129PTMetabolic pathwaysGlyoxylate and dicarboxylate metabolismPhosphoglycolate phosphatase 1.10.150.240 72 11 94 3.50 3.70
2wf7A02 81.56 Starch and sucrose metabolismLactococcus lactis subsp. lactisBeta-phosphoglucomutaseBeta-phosphoglucomutase [EC:5.4.2.6] 1.10.150.240 78 16 87 3.90 4.47
3e58A02 79.84 Streptococcus thermophilus LMG 18311Beta-phosphoglucomutase, putative 1.10.150.240 62 6 84 3.86 4.54
3ddhA02 79.72 Bacteroides thetaiotaomicronPutative haloacid dehalogenase-like family hydrolasePutative hydrolase of the HAD superfamily 1.10.150.240 78 8 83 3.49 4.19
2pkeA02 76.53 Xanthomonas campestris pv. campestrisPutative hydrolase of the HAD superfamilyHydrolase, haloacid delahogenase-like family 1.10.150.240 75 8 84 3.72 4.43
1swvA02 75.87 Bacillus cereusPhosphonoacetaldehyde hydrolase 1.10.150.240 78 8 88 4.30 4.86
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2px6A02
YAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2px6A02
YVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARS
FYYKLRAAEQ
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 13 Aug 2007 22:12

Assigning to "1.10.1470.20" based on similarity with "1xktA02"

Flow stage update by auto on 13 Aug 2007 22:09

No in_process hits for Domain "2px6A02" ready to be processed

Flow stage update by auto on 13 Aug 2007 22:09

NW result present for Domain "2px6A02"

Flow stage update by auto on 21 Jul 2007 23:04

All required files are present for Domain "2px6A02"

Flow stage update by auto on 20 Jul 2007 10:57

Beginning processing for Domain "2px6A02"

Insertion by auto on 20 Jul 2007 10:11

Final ChopClose added based on similarity with "1xktA"