CATH Domain: 2pwoB00 XML data for domain: 2pwoB00

Molscript image for 2pwoB00
2pwoB00
PDB coordinates for domain 2pwoB00

PDB 2pwo, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.375 Human Immunodeficiency Virus Type 1 Capsid Protein
1.10.375.10 Human Immunodeficiency Virus Type 1 Capsid Protein Gene3D
1.10.375.10.1
1.10.375.10.1.1
1.10.375.10.1.1.2
1.10.375.10.1.1.2.1
1.10.375.10.1.1.2.1.1

[top]
Segment boundaries for domain 2pwoB00

Chopping figure for domain 2pwoB00
DomainStart PDB ResidueStop PDB Residue
2pwoB00 1 145

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 1.10.375.10.1.1.2.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1eiaA01 85.78 Gag polyproteinEquine infectious anemia virus (ISOLATE WYOMING) 1.10.375.10 133 20 86 3.17 3.65
1em9B00 83.06 Rous sarcoma virus - Prague CGag polyprotein 1.10.375.10 141 12 90 4.43 4.87
1p7nA00 79.04 Rous sarcoma virus - Prague CGag polyprotein 1.10.375.10 176 9 72 3.33 4.58
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2pwoB00
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEW
DRLHPVHAGPIEPMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pwoB00
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEW
DRLHPVHAGPIEPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 28 Nov 2007 03:02

Assigning to "1.10.375.10" based on similarity with "2pwoD00"

Flow stage update by auto on 28 Nov 2007 03:02

No in_process hits for Domain "2pwoB00" ready to be processed

Update comment by auto on 28 Nov 2007 02:59

Domain "2pwoB00" hits Domain "2pwoC00" (100% over 100%) which is currently in process

Update comment by auto on 28 Nov 2007 02:55

Domain "2pwoB00" hits Domain "2pwoD00" (100% over 100%) which is currently in process

Update comment by auto on 28 Nov 2007 02:50

Domain "2pwoB00" hits Domain "2pwoA00" (100% over 100%) which is currently in process

Update comment by auto on 28 Nov 2007 02:41

Domain "2pwoB00" hits Domain "2pwmA00" (100% over 100%) which is currently in process

Flow stage update by auto on 28 Nov 2007 02:24

Domain "2pwoB00" hits Domain "2pwmA00" (100% over 100%) which is currently in process

Flow stage update by auto on 28 Nov 2007 02:24

NW result present for Domain "2pwoB00"

Flow stage update by auto on 24 Nov 2007 14:38

All required files are present for Domain "2pwoB00"

Flow stage update by auto on 23 Nov 2007 14:01

Beginning processing for Domain "2pwoB00"

Insertion by auto on 23 Nov 2007 11:02

Final ChopClose added based on similarity with "1m9cC"