CATH Domain: 2pw9C03 XML data for domain: 2pw9C03

Molscript image for 2pw9C03
2pw9C03
PDB coordinates for domain 2pw9C03

PDB 2pw9, Chain C, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.140 Cytidine Deaminase; domain 2
3.40.140.10 Cytidine Deaminase, domain 2 Gene3D
3.40.140.10.6
3.40.140.10.6.1
3.40.140.10.6.1.1
3.40.140.10.6.1.1.1
3.40.140.10.6.1.1.1.1

[top]
Segment boundaries for domain 2pw9C03

Chopping figure for domain 2pw9C03
DomainStart PDB ResidueStop PDB Residue
2pw9C01 7 31
2pw9C02 32 89
2pw9C03 120 257

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2pw9C03
FAPLADYCLPFAEIKSFIREALHSSPLGPQTHCVHGCGLWNNGRLQVYHEDVGRHNAVDKVLGSILLGRASNNSAVYTTG
RLTSDMVLKCARIGIPIIMSRTSPSSLGLALAKRSGATLVAYSRPERINVFNAPERIL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pw9C03
FAPLADYCLPFAEIKSFIREALHSSPLGPQTHCVHGCGLWNNGRLQVYHEDVGRHNAVDKVLGSILLGRASNNSAVYTTG
RLTSDMVLKCARIGIPIIMSRTSPSSLGLALAKRSGATLVAYSRPERINVFNAPERILTEGHHHHHH
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 08 Mar 2008 11:18

Assigning to "3.40.140.10" based on similarity with "2pw9A03"

Flow stage update by auto on 08 Mar 2008 11:08

No in_process hits for Domain "2pw9C03" ready to be processed

Update comment by auto on 03 Sep 2007 20:10

Domain "2pw9C03" hits Domain "2pw9A03" (95.2380952380952% over 98.6577181208054%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2pw9C03" hits Domain "2pw9A03" (95.2380952380952% over 98.6577181208054%) which is currently in process

Update comment by auto on 28 Aug 2007 18:21

Domain "2pw9C03" hits Domain "2pw9A03" (95.2380952380952% over 98.6577181208054%) which is currently in process

Flow stage update by auto on 28 Aug 2007 18:20

Domain "2pw9C03" hits Domain "2pw9A03" (95.2380952380952% over 98.6577181208054%) which is currently in process

Flow stage update by auto on 28 Aug 2007 18:20

NW result present for Domain "2pw9C03"

Flow stage update by auto on 21 Aug 2007 10:06

All required files are present for Domain "2pw9C03"

Flow stage update by auto on 20 Aug 2007 17:33

Beginning processing for Domain "2pw9C03"

Insertion by cuff on 20 Aug 2007 10:47

nice chopping