CATH Domain: 2pw8I00 XML data for domain: 2pw8I00

Molscript image for 2pw8I00
2pw8I00
PDB coordinates for domain 2pw8I00

PDB 2pw8, Chain I, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.70 Distorted Sandwich
2.70.10 Thrombin Inhibitor (Hirudin); Chain I
2.70.10.10 Thrombin Inhibitor (Hirudin), subunit I Gene3D
2.70.10.10.1
2.70.10.10.1.1
2.70.10.10.1.1.1
2.70.10.10.1.1.1.1
2.70.10.10.1.1.1.1.1

[top]
Segment boundaries for domain 2pw8I00

Chopping figure for domain 2pw8I00
DomainStart PDB ResidueStop PDB Residue
2pw8I00 1 65

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 2.70.10.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2hirA00 86.50 Hirudo medicinalisHirudin variant-1 2.70.10.10 49 83 82 2.18 2.64
1e0fI01 70.62 Haemadipsa sylvestrisThrombininhibitor 2.70.10.10 33 24 56 2.58 4.60
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2pw8I00
LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSGDFEEIPEELQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pw8I00
LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEXLQ
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 28 Nov 2007 02:44

Assigning to "2.70.10.10" based on similarity with "1hrtI00"

Flow stage update by auto on 28 Nov 2007 02:24

No in_process hits for Domain "2pw8I00" ready to be processed

Flow stage update by auto on 28 Nov 2007 02:24

NW result present for Domain "2pw8I00"

Flow stage update by auto on 24 Nov 2007 14:38

All required files are present for Domain "2pw8I00"

Flow stage update by auto on 23 Nov 2007 14:01

Beginning processing for Domain "2pw8I00"

Insertion by auto on 23 Nov 2007 11:02

Final ChopClose added based on similarity with "1hrtI"