CATH Domain: 2pw6A00 XML data for domain: 2pw6A00

Molscript image for 2pw6A00
2pw6A00
PDB coordinates for domain 2pw6A00

PDB 2pw6, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.830 Protocatechuate 4,5-dioxygenase; Chain B
3.40.830.10 Protocatechuate 4,5-dioxygenase; Chain B Gene3D
3.40.830.10.2
3.40.830.10.2.1
3.40.830.10.2.1.1
3.40.830.10.2.1.1.1
3.40.830.10.2.1.1.1.1

[top]
Segment boundaries for domain 2pw6A00

Chopping figure for domain 2pw6A00
DomainStart PDB ResidueStop PDB Residue
2pw6A00 14 271

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2pw6A00
RPALFLGHGPNVLEDNLYTRSWQKLGTLPRPQAIVVVSAHWFTRGTGVTAETLYDTHYPAPGSPALAQRLVELLAPIPVT
LDKEAWGFDHGSWGVLIKYPDADIPVQLSIDSSKPAAWHFEGRKLAALRDEGILVASGNVVHNLRTVKWHGDSSPYPWAT
SFNEYVKANLTWQGPVEQHPLVNYLDHEGGTLSNPTPEHYLPLLYVLGAWDGQEPITIPVEGIEGSLSLSVQIG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pw6A00
XTPLVKDIIXSSTRXPALFLGHGSPXNVLEDNLYTRSWQKLGXTLPRPQAIVVVSAHWFTRGTGVTAXETPPTIHDFGGF
PQALYDTHYPAPGSPALAQRLVELLAPIPVTLDKEAWGFDHGSWGVLIKXYPDADIPXVQLSIDSSKPAAWHFEXGRKLA
ALRDEGIXLVASGNVVHNLRTVKWHGDSSPYPWATSFNEYVKANLTWQGPVEQHPLVNYLDHEGGTLSNPTPEHYLPLLY
VLGAWDGQEPITIPVEGIEXGSLSXLSVQIG
BLAST against CATH

[top]
Domain History Events (58)

Domain assigned by cuff on 09 Apr 2008 13:57

same superfamily

Domain assignment manual match h by cuff on 09 Apr 2008 13:54

nice scores, same superfamily in scop

Domain assignment manual match t by tronnberg on 20 Sep 2007 11:05

SSAP: 74.7 OV: 74 SEQ: 11. Similar linkage and structure (only differ with one beta strand). The query's function is unknown.

Homcheck review by tronnberg on 20 Sep 2007 11:05

SSAP: 74.7 OV: 74 SEQ: 11. Similar linkage and structure (only differ with one beta strand). The query's function is unknown.

Flow stage update by tronnberg on 20 Sep 2007 11:05

SSAP: 74.7 OV: 74 SEQ: 11. Similar linkage and structure (only differ with one beta strand). The query's function is unknown.

Homcheck allotment by tronnberg on 20 Sep 2007 11:02

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 20 Sep 2007 11:02

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 17 Sep 2007 12:59

Domain "2pw6A00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 17 Sep 2007 12:58

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2pw6A00

Flow stage update by auto on 17 Sep 2007 11:52

Retrieved PRC_PFAMCATH results for job ID SID2900518745602167 and results inserted.

Domain scan prc pfamcath by auto on 17 Sep 2007 11:51

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 1 results for 2pw6A00

Update comment by auto on 17 Sep 2007 02:50

PRC_PFAMCATH job SID2900518745602167 is not yet finished.

Prc pfamcath submit by auto on 17 Sep 2007 02:47

The entry "2pw6A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 17 Sep 2007 02:47

The entry "2pw6A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 17 Sep 2007 02:11

Retrieved SSAP results for job ID SID6702403072876340 and results inserted.

Domain scan ssap cath by auto on 17 Sep 2007 02:10

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 104 results for 2pw6A00

Update comment by auto on 15 Sep 2007 14:26

SSAP job SID6702403072876340 is not yet finished.

Ssap cath submit by auto on 15 Sep 2007 14:16

The entry "2pw6A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 14:16

The entry "2pw6A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 08:13

Giving up on SSAP job SID0634282264883248 because submission time of Sun Sep 9 22:47:03 2007 is more than 345600 seconds older than current time (Sat Sep 15 08:13:40 2007).

Update comment by auto on 09 Sep 2007 23:25

SSAP job SID0634282264883248 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:47

The entry "2pw6A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:47

The entry "2pw6A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:17

Giving up on SSAP job SID8458846331890680 because submission time of Wed Sep 5 18:57:04 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:17:49 2007).

Update comment by auto on 05 Sep 2007 20:01

SSAP job SID8458846331890680 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 18:57

The entry "2pw6A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 18:57

The entry "2pw6A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 13:46

Retrieved PRC results for job ID SID7355044916995584 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 13:45

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 2pw6A00

Flow stage update by auto on 05 Sep 2007 04:31

The entry "2pw6A00" has been submitted to the PRC webservice.

Prc cath submit by auto on 05 Sep 2007 04:30

The entry "2pw6A00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 01:31

Retrieved HMM(SAM) results for job ID SID9871459150196144 and inserted them into the database.

Domain scan sam cath by auto on 05 Sep 2007 01:30

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2pw6A00

Update comment by auto on 04 Sep 2007 13:26

HMM(SAM) job SID9871459150196144 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:32

The entry "2pw6A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:32

The entry "2pw6A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 07:06

Retrieved "2pw6A00" CATHEDRAL results for job ID SID3495325738208064 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 07:04

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 475 results for 2pw6A00

Flow stage update by auto on 03 Sep 2007 14:33

The entry "2pw6A00" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Sep 2007 14:33

The entry "2pw6A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:49

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2pw6A00.scanlist" for "2pw6A00"

Write scan list by auto on 03 Sep 2007 12:49

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2pw6A00.scanlist" for domain "2pw6A00"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:32

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:33

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:22

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:23

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:29

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:13

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:16

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Sep 2007 18:10

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Sep 2007 18:04

No in_process hits for Domain "2pw6A00" ready to be processed

Flow stage update by auto on 01 Sep 2007 18:04

NW result present for Domain "2pw6A00"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2pw6A00"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2pw6A00"

Insertion by cuff on 23 Aug 2007 12:58

nice chopping