CATH Domain: 2pvqA02 XML data for domain: 2pvqA02

Molscript image for 2pvqA02
2pvqA02
PDB coordinates for domain 2pvqA02

PDB 2pvq, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1050 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2
1.20.1050.10 Gene3D
1.20.1050.10.16
1.20.1050.10.16.1
1.20.1050.10.16.1.1
1.20.1050.10.16.1.1.1
1.20.1050.10.16.1.1.1.1

[top]
Segment boundaries for domain 2pvqA02

Chopping figure for domain 2pvqA02
DomainStart PDB ResidueStop PDB Residue
2pvqA01 1 82
2pvqA01 189 201
2pvqA02 83 188

Structural Neighbourhood (14 entries)

There are 14 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.16.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 14 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2dsaA02 91.15 Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismBurkholderia xenovorans LB400 1.20.1050.10 106 40 97 1.55 1.60
1n2aA02 91.07 Metabolism of xenobiotics by cytochrome P450Glutathione metabolismGlutathione S-transferase [EC:2.5.1.18]Glutathione S-transferaseEscherichia coli K-12 1.20.1050.10 106 27 97 1.61 1.66
1dugA02 88.92 Fibrinogen gamma chainGlutathione S-transferase class-mu 26 kDa isozymeExternal side of plasma membraneFibrinogen complexEukaryotic cell surface binding 1.20.1050.10 105 21 97 2.09 2.15
1eemA02 85.39 Glutathione S-transferase [EC:2.5.1.18]Drug metabolism - cytochrome P450Glutathione S-transferase omega-1Metabolism of xenobiotics by cytochrome P450Homo sapiens 1.20.1050.10 115 16 88 2.42 2.73
1hqoA02 85.11 Soluble fractionCytosolProtein URE2Cytoplasmic sequestering of transcription factorProtein urmylation 1.20.1050.10 126 13 78 2.08 2.65
2gsqA02 84.83 Ommastrephes sloaniGlutathione S-transferase 1.20.1050.10 108 17 89 2.11 2.35
1aw9A02 84.80 Glutathione transferase III(A)Zea mays 1.20.1050.10 121 21 82 2.88 3.48
1v2aA02 83.98 Anopheles dirusGlutathione transferase gst1-6 1.20.1050.10 132 19 77 2.25 2.91
1gnwA02 83.84 Glutathione bindingMicrosomeChloroplast stromaPlasma membraneToxin catabolic process 1.20.1050.10 125 17 82 2.74 3.33
1nhyA02 83.35 Positive regulation of transcription from RNA polymerase II promoterCalcium ion bindingNucleusElongation factor 1-gamma 1Transcription coactivator activity 1.20.1050.10 139 11 73 2.02 2.75
1gwcA02 82.42 Aegilops tauschiiGlutathione S-transferase 1 1.20.1050.10 141 19 72 2.30 3.18
2c3nA02 81.51 Soluble fractionGlutathione S-transferase theta-1Glutathione metabolic processGlutathione transferase activityGlutathione metabolism 1.20.1050.10 160 24 64 2.16 3.36
3cbuA02 80.59 Glutathione S-transferase [EC:2.5.1.18]Ralstonia eutropha JMP134Metabolism of xenobiotics by cytochrome P450Probable gst-related proteinGlutathione metabolism 1.20.1050.10 132 18 75 2.50 3.30
2vo4A02 78.49 2,4-D inducible glutathione S-transferaseGlycine max 1.20.1050.10 132 13 71 2.53 3.52
[1]
Displaying entries 1 to 14 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2pvqA02
KPAYGSIERARLQEALGFCSDLHAAFSGLFAPNLSEEARAGVIANINRRLGQLEAMLSDKNAYWLGDDFTQPDAYASVII
GWGVGQKLDLSAYPKALKLRERVLAR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pvqA02
KPAYGSIERARLQEALGFCSDLHAAFSGLFAPNLSEEARAGVIANINRRLGQLEAMLSDKNAYWLGDDFTQPDAYASVII
GWGVGQKLDLSAYPKALKLRERVLAR
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 19 Jan 2008 17:26

Assigning to "1.20.1050.10" based on similarity with "2ntoA02"

Flow stage update by auto on 19 Jan 2008 17:07

No in_process hits for Domain "2pvqA02" ready to be processed

Flow stage update by auto on 19 Jan 2008 17:07

NW result present for Domain "2pvqA02"

Flow stage update by auto on 19 Jan 2008 11:04

All required files are present for Domain "2pvqA02"

Flow stage update by auto on 18 Jan 2008 08:13

Beginning processing for Domain "2pvqA02"

Insertion by auto on 18 Jan 2008 08:08

Final ChopClose added based on similarity with "2ntoA"