CATH Domain: 2puyB00 XML data for domain: 2puyB00

Molscript image for 2puyB00
2puyB00
PDB coordinates for domain 2puyB00

PDB 2puy, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.40 Herpes Virus-1
3.30.40.10 Zinc/RING finger domain, C3HC4 (zinc finger) Gene3D
3.30.40.10.3
3.30.40.10.3.1
3.30.40.10.3.1.1
3.30.40.10.3.1.1.1
3.30.40.10.3.1.1.1.1

[top]
Segment boundaries for domain 2puyB00

Chopping figure for domain 2puyB00
DomainStart PDB ResidueStop PDB Residue
2puyB00 484 543

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.40.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1xwhA00 86.99 Promoter bindingZinc ion bindingChromatin bindingUbiquitin mediated proteolysisAutoimmune regulator 3.30.40.10 66 43 87 2.62 2.98
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2puyB00
HMIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLKKEEAI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2puyB00
HMIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLKKEEAI
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 28 Nov 2007 02:43

Assigning to "3.30.40.10" based on similarity with "1mm2A00"

Flow stage update by auto on 28 Nov 2007 02:24

No in_process hits for Domain "2puyB00" ready to be processed

Flow stage update by auto on 28 Nov 2007 02:24

NW result present for Domain "2puyB00"

Flow stage update by auto on 24 Nov 2007 14:38

All required files are present for Domain "2puyB00"

Flow stage update by auto on 23 Nov 2007 14:01

Beginning processing for Domain "2puyB00"

Insertion by auto on 23 Nov 2007 11:02

Final ChopClose added based on similarity with "1mm2A"