CATH Domain: 2ptrA01 XML data for domain: 2ptrA01

Molscript image for 2ptrA01
2ptrA01
PDB coordinates for domain 2ptrA01

PDB 2ptr, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.275 Fumarase C; Chain B, domain 1
1.10.275.10 Fumarase/aspartase (N-terminal domain) Gene3D
1.10.275.10.4
1.10.275.10.4.1
1.10.275.10.4.1.1
1.10.275.10.4.1.1.1
1.10.275.10.4.1.1.1.1

[top]
Segment boundaries for domain 2ptrA01

Chopping figure for domain 2ptrA01
DomainStart PDB ResidueStop PDB Residue
2ptrA01 1 117
2ptrA02 118 381
2ptrA02 446 459
2ptrA03 382 445

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 1.10.275.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2qgaB01 92.39 Adenylosuccinate lyasePlasmodium vivax 1.10.275.10 114 39 95 1.31 1.37
1c3cA01 81.35 Thermotoga maritimaAdenylosuccinate lyaseAdenylosuccinate lyase [EC:4.3.2.2]Purine metabolismAlanine, aspartate and glutamate metabolism 1.10.275.10 91 20 74 2.81 3.78
1dofA02 81.17 Pyrobaculum aerophilumAdenylosuccinate lyase [EC:4.3.2.2]Purine metabolismAdenylosuccinate lyase (PurB)Alanine, aspartate and glutamate metabolism 1.10.275.10 85 18 69 2.69 3.89
1q5nA01 79.09 3-carboxy-cis,cis-muconate cycloisomeraseBenzoate degradation via hydroxylation3-carboxy-cis,cis-muconate cycloisomerase [EC:5.5.1.2]Metabolic pathwaysAcinetobacter sp. ADP1 1.10.275.10 99 14 80 3.42 4.26
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2ptrA01
MELSSLTAVSPVDGRYGDKVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADAIGYLDAIVASFSEEDAA
RIKTIERTTNHDVKAVEYFLKEKVAEIPELHAVSEFI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2ptrA01
MELSSLTAVSPVDGRYGDKVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADAIGYLDAIVASFSEEDAA
RIKTIERTTNHDVKAVEYFLKEKVAEIPELHAVSEFI
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 25 Mar 2009 17:35

Assigning to "1.10.275.10" based on similarity with "3bhgA01"

Flow stage update by auto on 25 Mar 2009 17:31

No in_process hits for Domain "2ptrA01" ready to be processed

Update comment by auto on 10 Dec 2008 14:34

Domain "2ptrA01" hits Domain "3bhgA01" (44.4444444444444% over 97.5%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:19

Domain "2ptrA01" hits Domain "3bhgA01" (44.4444444444444% over 97.5%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:17

NW result present for Domain "2ptrA01"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "2ptrA01"

Flow stage update by auto on 10 Dec 2008 14:15

Beginning processing for Domain "2ptrA01"

Insertion by auto on 05 Dec 2008 18:13

Final ChopClose added based on similarity with "2ptrB"