CATH Domain: 2ps2A01 XML data for domain: 2ps2A01

Molscript image for 2ps2A01
2ps2A01
PDB coordinates for domain 2ps2A01

PDB 2ps2, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.10 Enolase-like, N-terminal domain Gene3D
3.30.390.10.11
3.30.390.10.11.2
3.30.390.10.11.2.1
3.30.390.10.11.2.1.1
3.30.390.10.11.2.1.1.1

[top]
Segment boundaries for domain 2ps2A01

Chopping figure for domain 2ps2A01
DomainStart PDB ResidueStop PDB Residue
2ps2A01 3 121
2ps2A01 360 370
2ps2A02 122 359

Structural Neighbourhood (17 entries)

There are 17 matching structural neighberhood comparisons for CATH ID 3.30.390.10.11.2.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 17 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1nu5A01 89.10 Chloromuconate cycloisomerasePseudomonas sp. P51 3.30.390.10 116 28 87 1.62 1.85
1tkkA01 88.04 Bacillus subtilisL-Ala-D/L-Glu epimerase 3.30.390.10 115 28 87 1.69 1.93
2ovlA01 88.03 Toluene and xylene degradationStreptomyces coelicolorMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylationPutative racemase 3.30.390.10 123 24 90 2.39 2.66
3bjsA01 87.20 Polaromonas sp. JS666Mandelate racemase/muconate lactonizing enzyme 3.30.390.10 116 26 83 1.90 2.29
2zadA01 86.29 Thermotoga maritimaL-Ala-D/L-Glu epimerase 3.30.390.10 109 21 83 1.85 2.21
3go2A01 86.23 Burkholderia xenovorans LB400Putative uncharacterized protein 3.30.390.10 114 21 80 2.17 2.71
1ec7C01 85.56 Ascorbate and aldarate metabolismD-glucarate catabolic processGlucarate dehydratase activityGlucarate dehydrataseGlucarate dehydratase [EC:4.2.1.40] 3.30.390.10 136 16 86 4.04 4.70
2oqyA01 84.86 Muconate cycloisomeraseOceanobacillus iheyensis 3.30.390.10 142 23 79 3.08 3.87
2qgyB01 84.80 3.30.390.10 135 19 85 2.97 3.46
2qq6B01 84.24 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like protein 3.30.390.10 115 20 77 3.84 4.94
1tzzB01 84.08 Bradyrhizobium japonicumBll6730 protein 3.30.390.10 119 18 74 2.36 3.16
1rvkA01 83.83 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.30.390.10 115 17 81 3.92 4.81
1jpdX01 83.62 Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12 3.30.390.10 99 21 76 2.15 2.82
2hzgB01 83.12 Rhodobacter sphaeroides 2.4.1Mandelate racemase/muconate lactonizing enzyme/Enolase superfamily 3.30.390.10 143 20 76 3.10 4.03
2nqlA01 82.61 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.30.390.10 162 26 71 2.57 3.59
2pgwA01 82.00 Sinorhizobium melilotiToluene and xylene degradationBenzoate degradation via hydroxylationMuconate cycloisomerase [EC:5.5.1.1]Mandelate racemase/muconate lactonizing enzyme family protein 3.30.390.10 147 21 80 3.35 4.17
1stzA03 72.71 Thermotoga maritimaHeat-inducible transcription repressor hrcAHeat-inducible transcriptional repressor 3.30.390.60 89 14 63 3.04 4.76
[1]
Displaying entries 1 to 17 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2ps2A01
DLKIARIDVFQVDLPYSGGVYYLSFDATIVRITTDTGIEGWGESTPFGSNYIASHPRGVRAGIATMAPSLIGLDPRRVDR
INDAMDDALLGHEDAKTAIDVACWDIFGKSVGLDVLGEAVASY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2ps2A01
MSDLKIARIDVFQVDLPYSGGVYYLSAGREYRSFDATIVRITTDTGIEGWGESTPFGSNYIASHPRGVRAGIATMAPSLI
GLDPRRVDRINDAMDDALLGHEDAKTAIDVACWDIFGKSVGLDVLGEAVASYF
BLAST against CATH

[top]
Domain History Events (17)

Domain assigned by auto on 02 Apr 2008 11:48

Assigning to "3.30.390.10" based on similarity with "2pceA01"

Flow stage update by auto on 02 Apr 2008 11:47

No in_process hits for Domain "2ps2A01" ready to be processed

Update comment by auto on 02 Apr 2008 11:45

Domain "2ps2A01" hits Domain "2pceD01" (57.1428571428571% over 92.3076923076923%) which is currently in process

Update comment by auto on 02 Apr 2008 11:43

Domain "2ps2A01" hits Domain "2pceB01" (57.1428571428571% over 92.3076923076923%) which is currently in process

Update comment by auto on 02 Apr 2008 11:41

Domain "2ps2A01" hits Domain "2pceG01" (57.1428571428571% over 92.3076923076923%) which is currently in process

Update comment by auto on 02 Apr 2008 11:39

Domain "2ps2A01" hits Domain "2pceF01" (57.1428571428571% over 92.3076923076923%) which is currently in process

Update comment by auto on 02 Apr 2008 11:37

Domain "2ps2A01" hits Domain "2pceH01" (57.1428571428571% over 92.3076923076923%) which is currently in process

Update comment by auto on 02 Apr 2008 11:33

Domain "2ps2A01" hits Domain "2pceA01" (57.1428571428571% over 92.3076923076923%) which is currently in process

Update comment by auto on 02 Apr 2008 11:30

Domain "2ps2A01" hits Domain "2pceE01" (57.1428571428571% over 92.3076923076923%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "2ps2A01" hits Domain "2pceC01" (57.1428571428571% over 92.3076923076923%) which is currently in process

Update comment by auto on 03 Sep 2007 11:16

Domain "2ps2A01" hits Domain "2pceC01" (57.1428571428571% over 92.3076923076923%) which is currently in process

Update comment by auto on 01 Sep 2007 18:04

Domain "2ps2A01" hits Domain "2pceC01" (57.1428571428571% over 92.3076923076923%) which is currently in process

Flow stage update by auto on 01 Sep 2007 18:04

Domain "2ps2A01" hits Domain "2pceC01" (57.1428571428571% over 92.3076923076923%) which is currently in process

Flow stage update by auto on 01 Sep 2007 18:04

NW result present for Domain "2ps2A01"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2ps2A01"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2ps2A01"

Insertion by auto on 23 Aug 2007 15:31

Final ChopClose added based on similarity with "2pceA"