CATH Domain: 2pr7A00 XML data for domain: 2pr7A00

Molscript image for 2pr7A00
2pr7A00
PDB coordinates for domain 2pr7A00

PDB 2pr7, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.1000 Gene3D
3.40.50.1000.21
3.40.50.1000.21.1
3.40.50.1000.21.1.1
3.40.50.1000.21.1.1.1
3.40.50.1000.21.1.1.1.1

[top]
Segment boundaries for domain 2pr7A00

Chopping figure for domain 2pr7A00
DomainStart PDB ResidueStop PDB Residue
2pr7A00 0 136

Structural Neighbourhood (23 entries)

There are 23 matching structural neighberhood comparisons for CATH ID 3.40.50.1000.21.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 23 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3i28A01 89.59 PeroxisomeSoluble epoxide hydrolase [EC:3.3.2.10]Arachidonic acid metabolismEpoxide hydrolase activityEpoxide hydrolase 2 3.40.50.1000 135 25 91 2.56 2.79
2b0cA01 88.11 Phosphatase yihXGlucose-1-phosphatase activityPutative hydrolase of the HAD superfamilyEscherichia coli K-12 3.40.50.1000 133 21 93 2.70 2.87
2i6xA01 86.59 Hydrolase, haloacid dehalogenase-like familyPutative hydrolase of the HAD superfamilyPorphyromonas gingivalis 3.40.50.1000 127 21 90 3.12 3.46
2fi1A01 85.73 Hydrolase, haloacid dehalogenase-like familyStreptococcus pneumoniae 3.40.50.1000 123 13 90 2.64 2.93
3ed5A01 84.24 Putative HAD-hydrolase yfnBBacillus subtilis2-haloacid dehalogenase [EC:3.8.1.2]1,2-Dichloroethane degradationGamma-Hexachlorocyclohexane degradation 3.40.50.1000 140 14 88 3.14 3.55
2hdoA01 84.24 Phosphoglycolate phosphatase [EC:3.1.3.18]Lactobacillus plantarumMetabolic pathwaysGlyoxylate and dicarboxylate metabolismPhosphoglycolate phosphatase (Putative) 3.40.50.1000 134 12 88 2.79 3.14
1cqzA01 84.11 PeroxisomeMus musculusSoluble epoxide hydrolase [EC:3.3.2.10]Arachidonic acid metabolismEpoxide hydrolase 2 3.40.50.1000 162 22 77 2.47 3.20
3cnhA01 83.64 Hydrolase family proteinPutative hydrolase of the HAD superfamilyDeinococcus radiodurans 3.40.50.1000 114 21 82 3.05 3.70
2hszA01 83.54 Phosphoglycolate phosphatase [EC:3.1.3.18]Haemophilus somnus 129PTMetabolic pathwaysGlyoxylate and dicarboxylate metabolismPhosphoglycolate phosphatase 3.40.50.1000 148 17 85 3.07 3.61
3d6jA01 83.09 Phosphoglycolate phosphatase [EC:3.1.3.18]Putative haloacid dehalogenase-like hydrolaseBacteroides fragilis NCTC 9343Glyoxylate and dicarboxylate metabolismMetabolic pathways 3.40.50.1000 137 14 86 3.07 3.56
3e58B01 83.03 Streptococcus thermophilus LMG 18311Beta-phosphoglucomutase, putative 3.40.50.1000 136 14 85 3.21 3.76
2nyvA01 82.65 Phosphoglycolate phosphatase [EC:3.1.3.18]Glyoxylate and dicarboxylate metabolismMetabolic pathwaysAquifex aeolicusPhosphoglycolate phosphatase 3.40.50.1000 151 16 86 4.27 4.96
1te2A01 82.45 Fructose and mannose metabolismMetabolic pathwaysRiboflavin metabolismThiamine metabolismMetal ion binding 3.40.50.1000 141 15 85 2.93 3.44
2ah5A01 82.31 Glyoxylate and dicarboxylate metabolismMetabolic pathwaysPhosphoglycolate phosphatase [EC:3.1.3.18]Hydrolase, haloacid dehalogenase-like familyStreptococcus pneumoniae 3.40.50.1000 142 14 83 3.12 3.75
2fdrA01 82.22 Agrobacterium tumefaciens str. C58Putative uncharacterized protein 3.40.50.1000 150 18 80 3.28 4.10
2ho4B01 81.51 Mus musculusHaloacid dehalogenase-like hydrolase domain-containing protein 2 3.40.50.1000 159 18 78 3.78 4.81
2p11A01 81.45 Burkholderia xenovorans LB400Putative uncharacterized protein 3.40.50.1000 140 17 78 3.19 4.06
3bwvA01 80.07 Putative 5'(3')-deoxyribonucleotidaseStaphylococcus epidermidis ATCC 12228 3.40.50.1000 121 6 78 3.33 4.24
1zjjB01 79.49 4-nitrophenyl phosphatase [EC:3.1.3.41]Pyrococcus horikoshiiGamma-Hexachlorocyclohexane degradationPutative uncharacterized protein PH1952 3.40.50.1000 146 14 81 3.69 4.53
1wpgA04 78.25 Calcium ion bindingATP catabolic processER-Golgi intermediate compartmentCalcium-transporting ATPase activitySarcoplasmic/endoplasmic reticulum calcium ATPase 1 3.40.50.1000 156 10 73 3.63 4.92
3fvvA01 78.10 Bordetella pertussisPutative uncharacterized protein 3.40.50.1000 148 9 73 2.94 3.99
1nf2A01 78.10 Thermotoga maritimaPutative uncharacterized protein 3.40.50.1000 161 11 74 3.47 4.66
1rkuA01 78.03 Glycine, serine and threonine metabolismMetabolic pathwaysPhosphoserine / homoserine phosphotransferase [EC:3.1.3.3 2.7.1.39]Pseudomonas aeruginosaHomoserine kinase 3.40.50.1000 111 13 68 3.29 4.79
[1]
Displaying entries 1 to 23 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2pr7A00
GRGLIVDYAGVLDGTDEDQRRWRNLLAAAKKNGVGTVILSNDPGGLGAAPIRELETNGVVDKVLLSGELGVEKPEEAAFQ
AAADAIDLPRDCVLVDDSILNVRGAVEAGLVGVYYQQFDRAVVEIVGLFGLEGEF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pr7A00
GXRGLIVDYAGVLDGTDEDQRRWRNLLAAAKKNGVGTVILSNDPGGLGAAPIRELETNGVVDKVLLSGELGVEKPEEAAF
QAAADAIDLPXRDCVLVDDSILNVRGAVEAGLVGVYYQQFDRAVVEIVGLFGLEGEF
BLAST against CATH

[top]
Domain History Events (54)

Domain assigned by cuff on 04 Apr 2008 14:02

same superfamily

Domain assignment manual match h by cuff on 04 Apr 2008 14:01

ample evidence for homology

Domain assignment manual match t by tronnberg on 20 Sep 2007 10:14

SSAP: 83.7 OV: 85 SEQ: 16. Similar structure and linkage. Functionallt different. None of the matches with a assaigned CATH code has the same function as the query.

Homcheck review by tronnberg on 20 Sep 2007 10:14

SSAP: 83.7 OV: 85 SEQ: 16. Similar structure and linkage. Functionallt different. None of the matches with a assaigned CATH code has the same function as the query.

Flow stage update by tronnberg on 20 Sep 2007 10:14

SSAP: 83.7 OV: 85 SEQ: 16. Similar structure and linkage. Functionallt different. None of the matches with a assaigned CATH code has the same function as the query.

Homcheck allotment by tronnberg on 20 Sep 2007 10:08

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 20 Sep 2007 10:08

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Sep 2007 21:43

Domain "2pr7A00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 15 Sep 2007 21:42

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2pr7A00

Flow stage update by auto on 15 Sep 2007 18:11

Retrieved PRC_PFAMCATH results for job ID SID4347879339515936 and results inserted.

Domain scan prc pfamcath by auto on 15 Sep 2007 18:10

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 131 results for 2pr7A00

Update comment by auto on 15 Sep 2007 09:31

PRC_PFAMCATH job SID4347879339515936 is not yet finished.

Prc pfamcath submit by auto on 15 Sep 2007 08:59

The entry "2pr7A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 08:59

The entry "2pr7A00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Sep 2007 07:58

Retrieved SSAP results for job ID SID8572995478064480 and results inserted.

Domain scan ssap cath by auto on 15 Sep 2007 07:55

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2458 results for 2pr7A00

Update comment by auto on 09 Sep 2007 23:24

SSAP job SID8572995478064480 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:45

The entry "2pr7A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:45

The entry "2pr7A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:16

Giving up on SSAP job SID6072436337765951 because submission time of Wed Sep 5 18:55:20 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:16:19 2007).

Update comment by auto on 05 Sep 2007 20:00

SSAP job SID6072436337765951 is not yet finished.

Ssap cath submit by auto on 05 Sep 2007 18:55

The entry "2pr7A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 18:55

The entry "2pr7A00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 13:30

Retrieved PRC results for job ID SID8848786449709916 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 13:29

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 43 results for 2pr7A00

Flow stage update by auto on 05 Sep 2007 04:28

The entry "2pr7A00" has been submitted to the PRC webservice.

Prc cath submit by auto on 05 Sep 2007 04:28

The entry "2pr7A00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 01:14

Retrieved HMM(SAM) results for job ID SID8819252479664296 and inserted them into the database.

Domain scan sam cath by auto on 05 Sep 2007 01:13

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 29 results for 2pr7A00

Update comment by auto on 04 Sep 2007 13:25

HMM(SAM) job SID8819252479664296 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:30

The entry "2pr7A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:30

The entry "2pr7A00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 06:48

Retrieved "2pr7A00" CATHEDRAL results for job ID SID6124064753710496 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 06:47

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 10 results for 2pr7A00

Cathedral cath submit by auto on 03 Sep 2007 14:31

The entry "2pr7A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:31

The entry "2pr7A00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:47

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2pr7A00.scanlist" for "2pr7A00"

Write scan list by auto on 03 Sep 2007 12:47

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2pr7A00.scanlist" for domain "2pr7A00"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:32

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:33

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:22

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:23

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:29

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:13

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:16

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Sep 2007 18:10

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Sep 2007 18:04

No in_process hits for Domain "2pr7A00" ready to be processed

Flow stage update by auto on 01 Sep 2007 18:04

NW result present for Domain "2pr7A00"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2pr7A00"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2pr7A00"

Insertion by cuff on 23 Aug 2007 12:58

nice chopping