CATH Domain: 2pqvB00 XML data for domain: 2pqvB00

Molscript image for 2pqvB00
2pqvB00
PDB coordinates for domain 2pqvB00

PDB 2pqv, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.79 Nucleoside Triphosphate Pyrophosphohydrolase
3.90.79.10 Nucleoside Triphosphate Pyrophosphohydrolase Gene3D
3.90.79.10.7
3.90.79.10.7.1
3.90.79.10.7.1.1
3.90.79.10.7.1.1.1
3.90.79.10.7.1.1.1.1

[top]
Segment boundaries for domain 2pqvB00

Chopping figure for domain 2pqvB00
DomainStart PDB ResidueStop PDB Residue
2pqvB00 0 151

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.90.79.10.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3a6sA00 83.54 8-oxo-7,8-dihydroguanosine triphosphate pyrophosphatase activity7,8-dihydro-8-oxoguanine triphosphatase [EC:3.6.1.-]Magnesium ion bindingMutator mutT proteinManganese ion binding 3.90.79.10 125 24 79 2.83 3.55
3cngC02 83.08 NUDIX hydrolaseNitrosomonas europaea 3.90.79.10 139 11 83 2.48 2.96
1ktgA00 79.97 Caenorhabditis elegansInduction of apoptosisBis(5'-nucleosyl)-tetraphosphatase [asymmetrical][EC:3.6.1.-]Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) activity 3.90.79.10 137 12 83 3.26 3.92
1iryA00 79.58 CytoplasmGTPase activityHomo sapiens7,8-dihydro-8-oxoguanine triphosphataseProtein binding 3.90.79.10 156 16 82 3.32 4.01
2fkbC00 79.50 [EC:3.6.-.-]Uncharacterized Nudix hydrolase yfcDProtein bindingEscherichia coli K-12 3.90.79.10 161 9 81 3.24 3.95
2fmlA02 79.48 MutT/nudix family proteinEnterococcus faecalis 3.90.79.10 163 16 76 3.06 4.02
3fspA03 78.63 Geobacillus stearothermophilusA/G-specific adenine glycosylase 3.90.79.10 126 11 78 2.81 3.59
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2pqvB00
ATQQDFRTKVDNTVFGVRATALIVQNHKLLVTKDKGKYYTIGGAIQVNESTEDAVVREVKEELGVKAQAGQLAFVVENRF
EVDGVSYHNIEFHYLVDLLEDAPLTQEDEKRQPCEWIDLDKLQNIQLVPVFLKTALPDWEGQLRHIHLEE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2pqvB00
SNAXTQQDFRTKVDNTVFGVRATALIVQNHKLLVTKDKGKYYTIGGAIQVNESTEDAVVREVKEELGVKAQAGQLAFVVE
NRFEVDGVSYHNIEFHYLVDLLEDAPLTXQEDEKRQPCEWIDLDKLQNIQLVPVFLKTALPDWEGQLRHIHLEE
BLAST against CATH

[top]
Domain History Events (58)

Domain assigned by cuff on 03 Apr 2008 13:43

same superfamily

Domain assignment manual match h by cuff on 03 Apr 2008 13:33

ample evidence for homology

Domain assignment manual match t by tronnberg on 20 Sep 2007 10:00

SSAP: 82.1 OV: 86 SEQ: 18. Similar linkage and structure (differ with a beta strand). The query's function is unknown.

Homcheck review by tronnberg on 20 Sep 2007 10:00

SSAP: 82.1 OV: 86 SEQ: 18. Similar linkage and structure (differ with a beta strand). The query's function is unknown.

Flow stage update by tronnberg on 20 Sep 2007 10:00

SSAP: 82.1 OV: 86 SEQ: 18. Similar linkage and structure (differ with a beta strand). The query's function is unknown.

Homcheck allotment by tronnberg on 20 Sep 2007 09:57

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 20 Sep 2007 09:57

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 17 Sep 2007 12:52

Domain "2pqvB00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 17 Sep 2007 12:52

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2pqvB00

Flow stage update by auto on 17 Sep 2007 11:44

Retrieved PRC_PFAMCATH results for job ID SID6452735764872184 and results inserted.

Domain scan prc pfamcath by auto on 17 Sep 2007 11:43

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 23 results for 2pqvB00

Update comment by auto on 16 Sep 2007 10:31

PRC_PFAMCATH job SID6452735764872184 is not yet finished.

Flow stage update by auto on 16 Sep 2007 10:31

The entry "2pqvB00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 16 Sep 2007 10:31

The entry "2pqvB00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 16 Sep 2007 10:18

Retrieved SSAP results for job ID SID1055724490296080 and results inserted.

Domain scan ssap cath by auto on 16 Sep 2007 10:16

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 162 results for 2pqvB00

Update comment by auto on 15 Sep 2007 14:25

SSAP job SID1055724490296080 is not yet finished.

Flow stage update by auto on 15 Sep 2007 14:15

The entry "2pqvB00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 15 Sep 2007 14:15

The entry "2pqvB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Sep 2007 07:54

Giving up on SSAP job SID6727800787795568 because submission time of Sun Sep 9 22:45:11 2007 is more than 345600 seconds older than current time (Sat Sep 15 07:54:48 2007).

Update comment by auto on 09 Sep 2007 23:24

SSAP job SID6727800787795568 is not yet finished.

Ssap cath submit by auto on 09 Sep 2007 22:45

The entry "2pqvB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 22:45

The entry "2pqvB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Sep 2007 20:16

Giving up on SSAP job SID0085448247216936 because submission time of Wed Sep 5 18:55:04 2007 is more than 345600 seconds older than current time (Sun Sep 9 20:16:06 2007).

Update comment by auto on 05 Sep 2007 20:00

SSAP job SID0085448247216936 is not yet finished.

Flow stage update by auto on 05 Sep 2007 18:55

The entry "2pqvB00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Sep 2007 18:55

The entry "2pqvB00" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Sep 2007 13:28

Retrieved PRC results for job ID SID3389594551159680 and inserted them into the database.

Domain scan prc cath by auto on 05 Sep 2007 13:27

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 24 results for 2pqvB00

Flow stage update by auto on 05 Sep 2007 04:28

The entry "2pqvB00" has been submitted to the PRC webservice.

Prc cath submit by auto on 05 Sep 2007 04:28

The entry "2pqvB00" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Sep 2007 01:11

Retrieved HMM(SAM) results for job ID SID4693496621625792 and inserted them into the database.

Domain scan sam cath by auto on 05 Sep 2007 01:10

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 23 results for 2pqvB00

Update comment by auto on 04 Sep 2007 13:25

HMM(SAM) job SID4693496621625792 is not yet finished.

Sam cath submit by auto on 04 Sep 2007 10:30

The entry "2pqvB00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 10:30

The entry "2pqvB00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Sep 2007 06:46

Retrieved "2pqvB00" CATHEDRAL results for job ID SID2106909960281440 and inserted them into the database.

Domain scan cathedral cath by auto on 04 Sep 2007 06:45

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 21 results for 2pqvB00

Cathedral cath submit by auto on 03 Sep 2007 14:31

The entry "2pqvB00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 14:31

The entry "2pqvB00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Sep 2007 12:47

ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2pqvB00.scanlist" for "2pqvB00"

Write scan list by auto on 03 Sep 2007 12:47

Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2pqvB00.scanlist" for domain "2pqvB00"

Update comment by auto on 03 Sep 2007 10:11

Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 06:32

Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Sep 2007 02:37

Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 22:33

Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 18:22

Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 14:23

Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 10:16

Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.

Update comment by auto on 02 Sep 2007 02:29

Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 22:13

Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Sep 2007 18:16

Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 01 Sep 2007 18:10

No satisfactory AssignClose result found.

Flow stage update by auto on 01 Sep 2007 18:04

No in_process hits for Domain "2pqvB00" ready to be processed

Flow stage update by auto on 01 Sep 2007 18:04

NW result present for Domain "2pqvB00"

Flow stage update by auto on 24 Aug 2007 10:06

All required files are present for Domain "2pqvB00"

Flow stage update by auto on 23 Aug 2007 18:40

Beginning processing for Domain "2pqvB00"

Insertion by cuff on 23 Aug 2007 12:58

nice chopping